StarFunc result for job id Q96GR2

User Input

>input (724 residues)
MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHA
LELSVPEKVNNAQWDAPEEALWTTRADGRVRLRIDPSCPQLPYTVHRMFYEALDKYGDLI
ALGFKRQDKWEHISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFA
GGIVTGIYTTSSPEACQYIAYDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPP
NKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNIT
WTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSL
VNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDL
KPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETS
GPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAI
DEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLI
GDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQA
IEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFYQ
EQKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q924N5	0.944	0.948	0.000	721	0.863	0.867	Q924N5.pdb.gz	ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus OX=10116 GN=Acsbg1 PE=1 SV=1
2	AFDB:Q96GR2	1.000	1.000	0.000	724	1.000	1.000	Q96GR2.pdb.gz	ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens OX=9606 GN=ACSBG1 PE=1 SV=2
3	AFDB:Q2XU92	0.870	0.943	2.467E-90	667	0.453	0.492	Q2XU92.pdb.gz	ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus OX=10090 GN=Acsbg2 PE=1 SV=1
4	AFDB:A0A140VJD4	0.862	0.935	3.082E-90	666	0.449	0.488	A0A140VJD4.pdb.gz	A0A140VJD4_HUMAN Testicular tissue protein Li 8 OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:Q9V3S9	0.869	0.943	1.124E-78	666	0.373	0.405	Q9V3S9.pdb.gz	BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster OX=7227 GN=bgm PE=1 SV=1
6	AFDB:Q9V3U0	0.845	0.897	1.655E-72	681	0.348	0.370	Q9V3U0.pdb.gz	HMLL_DROME Long-chain-fatty-acid--CoA ligase heimdall OS=Drosophila melanogaster OX=7227 GN=hll PE=1 SV=1
7	AFDB:O53521	0.740	0.885	4.070E-52	600	0.251	0.303	O53521.pdb.gz	FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD15 PE=1 SV=3
8	AFDB:P33121	0.743	0.770	1.667E-49	698	0.232	0.241	P33121.pdb.gz	ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1 PE=1 SV=1
9	AFDB:P18163	0.732	0.757	4.982E-48	699	0.236	0.245	P18163.pdb.gz	ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus OX=10116 GN=Acsl1 PE=1 SV=1
10	AFDB:Q55DR6	0.755	0.817	6.827E-47	667	0.227	0.246	Q55DR6.pdb.gz	FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum OX=44689 GN=fcsA PE=1 SV=1
11	PDB:6q2mA	0.607	0.794	1.401E-34	544	0.177	0.235	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
12	PDB:5bsmA	0.580	0.776	4.594E-32	530	0.184	0.251	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
13	PDB:3r44A	0.522	0.725	8.018E-32	502	0.169	0.243	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
14	PDB:1ultA	0.532	0.703	2.144E-30	533	0.173	0.235	1ultA.pdb.gz
15	PDB:3b7wA	0.517	0.681	9.121E-30	537	0.144	0.194	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
16	PDB:7kydA	0.582	0.775	1.424E-29	534	0.177	0.240	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
17	PDB:5ie2A	0.575	0.806	6.407E-29	506	0.145	0.208	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
18	PDB:2p20A	0.491	0.550	9.461E-29	641	0.137	0.154	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
19	PDB:1ry2A	0.588	0.685	6.520E-27	615	0.124	0.146	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
20	PDB:5ja2A	0.469	0.283	9.107E-27	1238	0.162	0.095	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJD4	0.0	660	666	0.450	0.489	A0A140VJD4_HUMAN Testicular tissue protein Li 8 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q2XU92	0.0	666	667	0.449	0.487	ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus OX=10090 GN=Acsbg2 PE=1 SV=1
3	Q5FVE4	0.0	660	666	0.450	0.489	ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens OX=9606 GN=ACSBG2 PE=1 SV=2
4	Q924N5	0.0	1300	721	0.865	0.868	ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus OX=10116 GN=Acsbg1 PE=1 SV=1
5	Q96GR2	0.0	1514	724	1.000	1.000	ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens OX=9606 GN=ACSBG1 PE=1 SV=2
6	Q99PU5	0.0	1304	721	0.863	0.867	ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus OX=10090 GN=Acsbg1 PE=1 SV=1
7	Q9V3S9	3.81e-171	508	666	0.366	0.398	BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster OX=7227 GN=bgm PE=1 SV=1
8	Q9V3U0	1.07e-142	435	681	0.360	0.383	HMLL_DROME Long-chain-fatty-acid--CoA ligase heimdall OS=Drosophila melanogaster OX=7227 GN=hll PE=1 SV=1
9	O53521	6.24e-74	253	600	0.258	0.312	FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD15 PE=1 SV=3
10	P9WQ53	4.14e-61	217	571	0.220	0.278	FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD11 PE=3 SV=1
11	Q55DR6	2.06e-52	195	667	0.238	0.258	FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum OX=44689 GN=fcsA PE=1 SV=1
12	Q9T009	8.08e-49	184	666	0.236	0.257	LACS5_ARATH Long chain acyl-CoA synthetase 5 OS=Arabidopsis thaliana OX=3702 GN=LACS5 PE=2 SV=1
13	P33121	1.75e-48	184	698	0.240	0.249	ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1 PE=1 SV=1
14	Q9XIA9	2.75e-47	180	665	0.244	0.266	LACS2_ARATH Long chain acyl-CoA synthetase 2 OS=Arabidopsis thaliana OX=3702 GN=LACS2 PE=2 SV=1
15	P18163	5.17e-47	180	699	0.240	0.249	ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus OX=10116 GN=Acsl1 PE=1 SV=1
16	Q9T0A0	7.53e-47	179	666	0.233	0.254	LACS4_ARATH Long chain acyl-CoA synthetase 4 OS=Arabidopsis thaliana OX=3702 GN=LACS4 PE=2 SV=1
17	Q2I824	1.31e-45	175	662	0.235	0.257	Q2I824_GOSHI Long-chain-fatty-acid--CoA ligase OS=Gossypium hirsutum OX=3635 GN=ACS1 PE=2 SV=1
18	Q9ULC5	1.89e-45	175	683	0.236	0.250	ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens OX=9606 GN=ACSL5 PE=1 SV=1
19	P41216	2.33e-45	175	699	0.231	0.239	ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus OX=10090 GN=Acsl1 PE=1 SV=2
20	Q2I823	8.49e-45	172	663	0.229	0.250	Q2I823_GOSHI Long-chain-fatty-acid--CoA ligase OS=Gossypium hirsutum OX=3635 GN=ACS2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	3.2e-96	334.2	AMP-binding enzyme
2	PF14931 IFT20	1.4e+02	14.1	Intraflagellar transport complex B, subunit 20
3	PF06892 Phage_CP76	4.6e+02	12.1	Phage regulatory protein CII (CP76)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258873

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293217	0.950	Peroxisomal acyl-coenzyme A oxidase 1
2	9606.ENSP00000307697	0.944	Peroxisomal acyl-coenzyme A oxidase 2
3	9606.ENSP00000233710	0.941	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
4	9606.ENSP00000477602	0.928	Elongation of very long chain fatty acids protein 1
5	9606.ENSP00000304592	0.922	Fatty acid synthase
6	9606.ENSP00000278840	0.919	Fatty acid desaturase 2
7	9606.ENSP00000378105	0.917	Elongation of very long chain fatty acids protein 6
8	9606.ENSP00000310688	0.891	ATP-binding cassette sub-family D member 2
9	9606.ENSP00000218104	0.886	ATP-binding cassette sub-family D member 1
10	9606.ENSP00000333664	0.840	3-ketoacyl-CoA thiolase, peroxisomal
11	9606.ENSP00000285093	0.832	3-ketoacyl-CoA thiolase, mitochondrial
12	9606.ENSP00000359233	0.832	ATP-binding cassette sub-family D member 3
13	9606.ENSP00000349396	0.829	ATP-binding cassette sub-family D member 4
14	9606.ENSP00000309757	0.819	Lipoprotein lipase
15	9606.ENSP00000265052	0.808	Monoglyceride lipase
16	9606.ENSP00000267842	0.808	Very long-chain acyl-CoA synthetase
17	9606.ENSP00000312618	0.778	Acyl-CoA dehydrogenase family member 9, mitochondrial
18	9606.ENSP00000359871	0.750	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
19	9606.ENSP00000438689	0.739	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
20	9606.ENSP00000350012	0.725	Long-chain-fatty-acid--CoA ligase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004467	1.000	long-chain fatty acid-CoA ligase activity
GO:0031957	0.996	very long-chain fatty acid-CoA ligase activity
GO:0005488	0.968	binding
GO:0005515	0.964	protein binding
GO:0016740	0.376	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006629	0.979	lipid metabolic process
GO:0032787	0.976	monocarboxylic acid metabolic process
GO:0044255	0.969	cellular lipid metabolic process
GO:1901576	0.963	organic substance biosynthetic process
GO:0006631	0.962	fatty acid metabolic process
GO:0008610	0.949	lipid biosynthetic process
GO:0001676	0.888	long-chain fatty acid metabolic process
GO:0033875	0.879	ribonucleoside bisphosphate metabolic process
GO:0034032	0.873	purine nucleoside bisphosphate metabolic process
GO:0009150	0.873	purine ribonucleotide metabolic process
GO:0035383	0.871	thioester metabolic process
GO:0006637	0.850	acyl-CoA metabolic process
GO:0044249	0.840	cellular biosynthetic process
GO:1901568	0.834	fatty acid derivative metabolic process
GO:1901570	0.653	fatty acid derivative biosynthetic process
GO:0035337	0.479	fatty-acyl-CoA metabolic process
GO:0034030	0.448	ribonucleoside bisphosphate biosynthetic process
GO:0034033	0.448	purine nucleoside bisphosphate biosynthetic process
GO:0009152	0.429	purine ribonucleotide biosynthetic process
GO:0035384	0.418	thioester biosynthetic process
GO:0071616	0.400	acyl-CoA biosynthetic process
GO:0065007	0.310	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0005829	0.990	cytosol
GO:0016020	0.989	membrane
GO:0043229	0.985	intracellular organelle
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0071944	0.892	cell periphery
GO:0005886	0.863	plasma membrane
GO:0005783	0.844	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15421	1.000	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	1.000	long-chain-fatty-acid--CoA ligase.
EC:2.-.-.-	0.376	Transferases.

[back to server]