StarFunc result for job id Q96GS6

User Input

>input (310 residues)
MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGAAPLGTLRASS
GAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNRVSCMYVRCVPGARYTVLFSHGN
AVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGIS
PDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKV
SKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRF
ISQELPSQRA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XIJ5	0.966	0.966	1.606E-65	310	0.929	0.929	Q5XIJ5.pdb.gz	AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus OX=10116 GN=Abhd17a PE=1 SV=1
2	AFDB:Q6PCB6	0.861	0.812	1.917E-56	329	0.765	0.720	Q6PCB6.pdb.gz	AB17C_HUMAN Alpha/beta hydrolase domain-containing protein 17C OS=Homo sapiens OX=9606 GN=ABHD17C PE=1 SV=2
3	AFDB:Q5VST6	0.885	0.951	6.588E-54	288	0.732	0.788	Q5VST6.pdb.gz	AB17B_HUMAN Alpha/beta hydrolase domain-containing protein 17B OS=Homo sapiens OX=9606 GN=ABHD17B PE=1 SV=1
4	AFDB:Q9VBX8	0.890	0.964	3.275E-51	286	0.626	0.678	Q9VBX8.pdb.gz	Q9VBX8_DROME IP15857p OS=Drosophila melanogaster OX=7227 GN=CG11935 PE=1 SV=2
5	AFDB:Q21221	0.857	0.801	1.106E-43	332	0.552	0.515	Q21221.pdb.gz	AHO3_CAEEL Alpha/beta hydrolase domain-containing protein aho-3 OS=Caenorhabditis elegans OX=6239 GN=aho-3 PE=1 SV=2
6	AFDB:Q84JV3	0.794	0.837	2.760E-34	294	0.384	0.405	Q84JV3.pdb.gz	Q84JV3_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g31020 PE=1 SV=1
7	AFDB:Q8VYT1	0.792	0.900	3.530E-34	272	0.384	0.438	Q8VYT1.pdb.gz	Q8VYT1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g66900 PE=1 SV=1
8	AFDB:Q9S7U7	0.774	0.666	7.848E-34	361	0.397	0.341	Q9S7U7.pdb.gz	Q9S7U7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F28J7.1 PE=1 SV=1
9	AFDB:K7EQ25	0.383	0.519	5.730E-25	225	0.510	0.702	K7EQ25.pdb.gz	K7EQ25_HUMAN Abhydrolase domain containing 17A, depalmitoylase OS=Homo sapiens OX=9606 GN=ABHD17A PE=1 SV=1
10	AFDB:Q8RXP6	0.656	0.660	1.751E-20	308	0.200	0.201	Q8RXP6.pdb.gz	WAV2_ARATH Alpha/beta hydrolase domain-containing protein WAV2 OS=Arabidopsis thaliana OX=3702 GN=WAV2 PE=2 SV=1
11	PDB:7prmA	0.573	0.600	4.561E-12	295	0.161	0.169	7prmA.pdb.gz	Development of High Brain-Penetrant and Reversible Monoacylglycerol Lipase PET Tracers for Neuroimaging.
12	PDB:2ocgA	0.512	0.616	1.297E-11	254	0.123	0.150	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
13	PDB:6eicB	0.570	0.630	1.467E-11	279	0.129	0.143	6eicB.pdb.gz
14	PDB:5xb6A	0.537	0.543	2.121E-11	306	0.148	0.150	5xb6A.pdb.gz
15	PDB:2gbfA	0.493	0.236	1.049E-10	730	0.126	0.053	2gbfA.pdb.gz	Crystal Structures of DPP-IV (CD26) from Rat Kidney Exhibit Flexible Accommodation of Peptidase-Selective Inhibitors.
16	PDB:4kryE	0.530	0.502	1.186E-10	329	0.135	0.128	4kryE.pdb.gz
17	PDB:4n8eB	0.508	0.240	1.261E-10	734	0.116	0.049	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.
18	PDB:6y0fC	0.465	0.227	1.261E-10	722	0.148	0.064	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
19	PDB:5jzsB	0.543	0.588	1.939E-10	284	0.168	0.183	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
20	PDB:7jn7A	0.549	0.218	1.939E-10	846	0.158	0.058	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5XIJ5	0.0	535	310	0.929	0.929	AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus OX=10116 GN=Abhd17a PE=1 SV=1
2	Q96GS6	0.0	639	310	1.000	1.000	AB17A_HUMAN Alpha/beta hydrolase domain-containing protein 17A OS=Homo sapiens OX=9606 GN=ABHD17A PE=1 SV=1
3	B5DFK7	4.08e-176	491	320	0.765	0.741	AB17C_RAT Alpha/beta hydrolase domain-containing protein 17C OS=Rattus norvegicus OX=10116 GN=Abhd17c PE=1 SV=1
4	Q8VCV1	4.08e-176	491	320	0.765	0.741	AB17C_MOUSE Alpha/beta hydrolase domain-containing protein 17C OS=Mus musculus OX=10090 GN=Abhd17c PE=1 SV=2
5	Q6PCB6	2.34e-175	489	329	0.758	0.714	AB17C_HUMAN Alpha/beta hydrolase domain-containing protein 17C OS=Homo sapiens OX=9606 GN=ABHD17C PE=1 SV=2
6	Q5VST6	5.72e-162	454	288	0.732	0.788	AB17B_HUMAN Alpha/beta hydrolase domain-containing protein 17B OS=Homo sapiens OX=9606 GN=ABHD17B PE=1 SV=1
7	Q6AY17	9.89e-162	454	288	0.729	0.785	AB17B_RAT Alpha/beta hydrolase domain-containing protein 17B OS=Rattus norvegicus OX=10116 GN=Abhd17b PE=1 SV=1
8	Q7M759	9.89e-162	454	288	0.729	0.785	AB17B_MOUSE Alpha/beta hydrolase domain-containing protein 17B OS=Mus musculus OX=10090 GN=Abhd17b PE=1 SV=1
9	A0A4D6K2Q0	1.04e-137	395	349	0.626	0.556	A0A4D6K2Q0_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=CG11935 PE=1 SV=1
10	Q9VBX8	1.26e-137	392	286	0.626	0.678	Q9VBX8_DROME IP15857p OS=Drosophila melanogaster OX=7227 GN=CG11935 PE=1 SV=2
11	Q21221	1.45e-118	346	332	0.552	0.515	AHO3_CAEEL Alpha/beta hydrolase domain-containing protein aho-3 OS=Caenorhabditis elegans OX=6239 GN=aho-3 PE=1 SV=2
12	K7EQ25	5.72e-109	317	225	0.510	0.702	K7EQ25_HUMAN Abhydrolase domain containing 17A, depalmitoylase OS=Homo sapiens OX=9606 GN=ABHD17A PE=1 SV=1
13	Q84JV3	8.13e-74	231	294	0.403	0.425	Q84JV3_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g31020 PE=1 SV=1
14	Q9S7U7	6.72e-72	228	361	0.368	0.316	Q9S7U7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F28J7.1 PE=1 SV=1
15	Q8VYT1	1.21e-70	222	272	0.339	0.386	Q8VYT1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g66900 PE=1 SV=1
16	P9WLC7	1.28e-23	99.8	281	0.226	0.249	Y2307_MYCTU Uncharacterized protein Rv2307c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2307c PE=1 SV=1
17	Q4GYA0	4.47e-18	86.7	670	0.194	0.090	Q4GYA0_TRYB2 Serine peptidase, putative serine peptidase, Clan SC, Family S9D OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4780 PE=4 SV=1
18	P54069	3.68e-15	76.6	299	0.187	0.194	BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bem46 PE=2 SV=3
19	Q80UX8	8.33e-15	75.9	337	0.190	0.175	ABHDD_MOUSE Protein ABHD13 OS=Mus musculus OX=10090 GN=Abhd13 PE=2 SV=1
20	Q8RXP6	3.02e-14	73.9	308	0.174	0.175	WAV2_ARATH Alpha/beta hydrolase domain-containing protein WAV2 OS=Arabidopsis thaliana OX=3702 GN=WAV2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	8.9e-06	37.1	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	47	15.1	Alpha/beta hydrolase domain
3	PF02230 Abhydrolase_2	41	15.4	Phospholipase/Carboxylesterase
4	PF12695 Abhydrolase_5	52	15.1	Alpha/beta hydrolase family
5	PF12697 Abhydrolase_6	0.0026	29.9	Alpha/beta hydrolase family
6	PF16929 Asp2	5.7e+02	10.9	Accessory Sec system GspB-transporter
7	PF20434 BD-FAE	4.7	18.2	BD-FAE
8	PF01738 DLH	8.6	17.4	Dienelactone hydrolase family
9	PF05677 DUF818	1e+02	13.3	Chlamydia CHLPS protein (DUF818)
10	PF03959 FSH1	4.4	18.4	Serine hydrolase (FSH1)
11	PF12146 Hydrolase_4	3.7e-10	51.0	Serine aminopeptidase, S33
12	PF03583 LIP	7.5e+02	10.8	Secretory lipase
13	PF00326 Peptidase_S9	0.024	25.7	Prolyl oligopeptidase family
14	PF05728 UPF0227	12	17.3	Uncharacterised protein family (UPF0227)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000007057

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000009073	0.783	Lysophospholipase II
2	9555.ENSPANP00000000946	0.762	Lysophospholipase-like 1
3	9555.ENSPANP00000011191	0.757	NRAS proto-oncogene, GTPase
4	9555.ENSPANP00000017334	0.692	Sterol carrier protein 2
5	9555.ENSPANP00000004898	0.660	annotation not available
6	9555.ENSPANP00000003127	0.653	Uncharacterized protein
7	9555.ENSPANP00000005038	0.653	KRAS proto-oncogene, GTPase
8	9555.ENSPANP00000009406	0.653	annotation not available
9	9555.ENSPANP00000018337	0.646	Secretory carrier membrane protein 4
10	9555.ENSPANP00000004901	0.643	SH3-domain GRB2-like 1
11	9555.ENSPANP00000001229	0.632	Uncharacterized protein
12	9555.ENSPANP00000001773	0.632	annotation not available
13	9555.ENSPANP00000008486	0.596	Nicotinamide riboside kinase 2
14	9555.ENSPANP00000006440	0.565	Palmitoyl-protein thioesterase 1
15	9555.ENSPANP00000003809	0.557	Dimethylglycine dehydrogenase
16	9555.ENSPANP00000015610	0.538	Abhydrolase domain containing 6
17	9555.ENSPANP00000020711	0.523	CoA synthase
18	9555.ENSPANP00000011071	0.505	Epoxide hydrolase 2, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008474	1.000	palmitoyl-(protein) hydrolase activity
GO:0005515	0.887	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0042157	0.981	lipoprotein metabolic process
GO:0098732	0.976	macromolecule deacylation
GO:0050789	0.975	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0035601	0.964	protein deacylation
GO:1901565	0.962	organonitrogen compound catabolic process
GO:0030163	0.903	protein catabolic process
GO:0048518	0.888	positive regulation of biological process
GO:0009987	0.874	cellular process
GO:0048522	0.874	positive regulation of cellular process
GO:0048523	0.861	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.998	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.997	intracellular organelle
GO:0012505	0.991	endomembrane system
GO:0005634	0.988	nucleus
GO:0031090	0.983	organelle membrane
GO:0043233	0.962	organelle lumen
GO:0070013	0.952	intracellular organelle lumen
GO:0030054	0.944	cell junction
GO:0098588	0.911	bounding membrane of organelle
GO:0031982	0.898	vesicle
GO:0045202	0.897	synapse
GO:0031410	0.887	cytoplasmic vesicle
GO:0030659	0.813	cytoplasmic vesicle membrane
GO:0010008	0.803	endosome membrane
GO:0005654	0.630	nucleoplasm
GO:0098978	0.481	glutamatergic synapse
GO:0098794	0.468	postsynapse
GO:0098590	0.379	plasma membrane region
GO:0099572	0.377	postsynaptic specialization
GO:0032279	0.368	asymmetric synapse
GO:0097060	0.364	synaptic membrane
GO:0014069	0.363	postsynaptic density
GO:0045211	0.352	postsynaptic membrane
GO:0055037	0.312	recycling endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19233	1.000	H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein]
EC:3.1.2.22	1.000	palmitoyl-protein hydrolase.

[back to server]