StarFunc result for job id Q96GW9

User Input

>input (593 residues)
MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHI
GHLYSALLADALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATAGLAPTELCDRVSEQ
FQQLFQEAGISCTDFIRTTEARHRVAVQHFWGVLKSRGLLYKGVYEGWYCASDECFLPEA
KVTQQPGPSGDSFPVSLESGHPVSWTKEENYIFRLSQFRKPLQRWLRGNPQAITPEPFHH
VVLQWLDEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVIGYPNAEFKSW
WPATSHIIGKDILKFHAIYWPAFLLGAGMSPPQRICVHSHWTVCGQKMSKSLGNVVDPRT
CLNRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLNSELADALGGLLNRCTAKRINPSET
YPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCV
RQTNGFVQRHAPWKLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLG
VSASERSLGELYFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96GW9	1.000	1.000	0.000	593	1.000	1.000	Q96GW9.pdb.gz	SYMM_HUMAN Methionine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=MARS2 PE=1 SV=2
2	AFDB:Q499X9	0.949	0.960	6.500E-92	586	0.858	0.869	Q499X9.pdb.gz	SYMM_MOUSE Methionine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Mars2 PE=1 SV=2
3	AFDB:Q9VFL5	0.870	0.886	1.343E-56	582	0.413	0.421	Q9VFL5.pdb.gz	SYMM_DROME Methionine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MetRS-m PE=1 SV=2
4	AFDB:O14000	0.827	0.908	5.103E-52	539	0.363	0.399	O14000.pdb.gz	SYMM_SCHPO Probable methionine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27E2.06c PE=3 SV=1
5	AFDB:Q38C91	0.831	0.641	3.892E-51	773	0.371	0.285	Q38C91.pdb.gz	Q38C91_TRYB2 methionine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6470 PE=1 SV=1
6	AFDB:Q4QCD2	0.834	0.665	5.304E-50	747	0.364	0.289	Q4QCD2.pdb.gz	Q4QCD2_LEIMA methionine--tRNA ligase OS=Leishmania major OX=5664 GN=LMJF_21_0810 PE=1 SV=1
7	AFDB:A0A1D8PP08	0.796	0.818	5.514E-48	577	0.332	0.341	A0A1D8PP08.pdb.gz	A0A1D8PP08_CANAL methionine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSM1 PE=3 SV=1
8	AFDB:P9WFU5	0.809	0.922	1.085E-47	519	0.347	0.397	P9WFU5.pdb.gz	SYM_MYCTU Methionine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=metG PE=1 SV=1
9	AFDB:P22438	0.798	0.823	7.514E-47	575	0.337	0.348	P22438.pdb.gz	SYMM_YEAST Methionine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSM1 PE=1 SV=2
10	AFDB:Q9M2T9	0.819	0.789	2.695E-45	616	0.317	0.305	Q9M2T9.pdb.gz	SYMM_ARATH Methionine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA1 PE=2 SV=1
11	PDB:6ax8A	0.802	0.931	7.462E-45	509	0.347	0.405	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
12	PDB:7d5cA	0.627	0.419	1.512E-15	919	0.157	0.101	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
13	PDB:3zgzD	0.589	0.416	4.383E-15	867	0.165	0.113	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
14	PDB:6lpfB	0.611	0.376	1.650E-13	1006	0.175	0.103	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.
15	PDB:4ariA	0.534	0.395	6.090E-13	821	0.174	0.125	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
16	PDB:1u0bB	0.463	0.580	4.216E-12	461	0.132	0.169	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
17	PDB:1li7B	0.436	0.659	3.441E-10	375	0.116	0.184	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
18	PDB:5b63C	0.445	0.472	1.800E-6	553	0.091	0.098	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
19	PDB:5yymA	0.469	0.477	2.650E-6	581	0.084	0.086	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
20	PDB:1f7uA	0.486	0.476	4.735E-6	606	0.089	0.087	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q499X9	0.0	1041	586	0.858	0.869	SYMM_MOUSE Methionine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Mars2 PE=1 SV=2
2	Q96GW9	0.0	1225	593	1.000	1.000	SYMM_HUMAN Methionine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=MARS2 PE=1 SV=2
3	Q9VFL5	2.48e-165	485	582	0.437	0.445	SYMM_DROME Methionine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MetRS-m PE=1 SV=2
4	O14000	8.32e-134	403	539	0.361	0.397	SYMM_SCHPO Probable methionine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27E2.06c PE=3 SV=1
5	Q4QCD2	2.57e-129	398	747	0.373	0.296	Q4QCD2_LEIMA methionine--tRNA ligase OS=Leishmania major OX=5664 GN=LMJF_21_0810 PE=1 SV=1
6	Q38C91	2.32e-126	391	773	0.388	0.298	Q38C91_TRYB2 methionine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6470 PE=1 SV=1
7	A0A1D8PP08	2.54e-116	359	577	0.349	0.359	A0A1D8PP08_CANAL methionine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSM1 PE=3 SV=1
8	P9WFU5	2.15e-103	324	519	0.349	0.399	SYM_MYCTU Methionine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=metG PE=1 SV=1
9	P22438	1.18e-102	324	575	0.339	0.350	SYMM_YEAST Methionine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSM1 PE=1 SV=2
10	Q9M2T9	1.03e-101	323	616	0.312	0.300	SYMM_ARATH Methionine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA1 PE=2 SV=1
11	Q8IJ60	5.23e-83	280	889	0.287	0.191	Q8IJ60_PLAF7 methionine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1034900 PE=3 SV=1
12	P00959	3.23e-42	163	677	0.223	0.195	SYM_ECOLI Methionine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=metG PE=1 SV=2
13	Q68FL6	2.15e-32	135	902	0.218	0.143	SYMC_MOUSE Methionine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Mars1 PE=1 SV=1
14	D3Z941	3.44e-32	134	902	0.228	0.150	D3Z941_RAT Methionine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mars1 PE=1 SV=1
15	Q8I716	7.09e-32	133	749	0.125	0.099	Q8I716_PLAF7 methionine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1005000 PE=3 SV=1
16	P56192	2.29e-30	129	900	0.219	0.144	SYMC_HUMAN Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2
17	A1ZBE9	1.05e-26	118	1022	0.239	0.139	A1ZBE9_DROME Methionine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=MetRS PE=1 SV=1
18	Q8MRS4	1.21e-26	117	1012	0.239	0.140	Q8MRS4_DROME Methionine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=MetRS PE=2 SV=1
19	Q9SVN5	4.76e-26	115	797	0.207	0.154	SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g13780 PE=2 SV=1
20	Q9UUF2	9.83e-26	114	782	0.233	0.176	SYMC_SCHPO Probable methionine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rar1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08264 Anticodon_1	0.39	22.1	Anticodon-binding domain of tRNA ligase
2	PF19303 Anticodon_3	0.012	26.9	Anticodon binding domain of methionyl tRNA ligase
3	PF07065 D123	6.4e+02	10.8	D123
4	PF07430 PP1	8.6e+02	11.4	Phloem filament protein PP1 cystatin-like domain
5	PF00133 tRNA-synt_1	4.5e-16	69.9	tRNA synthetases class I (I, L, M and V)
6	PF01406 tRNA-synt_1e	0.0023	28.9	tRNA synthetases class I (C) catalytic domain
7	PF09334 tRNA-synt_1g	1.7e-104	361.4	tRNA synthetases class I (M)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282276

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362576	0.957	Tyrosine--tRNA ligase, cytoplasmic
2	9606.ENSP00000395196	0.955	Probable glutamate--tRNA ligase, mitochondrial
3	9606.ENSP00000355890	0.952	Bifunctional glutamate/proline--tRNA ligase
4	9606.ENSP00000220058	0.950	Methionyl-tRNA formyltransferase, mitochondrial
5	9606.ENSP00000307567	0.949	Glutamine--tRNA ligase
6	9606.ENSP00000377954	0.947	Leucine--tRNA ligase, cytoplasmic
7	9606.ENSP00000358549	0.923	Probable arginine--tRNA ligase, mitochondrial
8	9606.ENSP00000364794	0.922	Isoleucine--tRNA ligase, cytoplasmic
9	9606.ENSP00000359976	0.916	Cystathionine gamma-lyase
10	9606.ENSP00000355536	0.915	Methionine synthase
11	9606.ENSP00000320658	0.908	Tyrosine--tRNA ligase, mitochondrial
12	9606.ENSP00000408576	0.908	Probable leucine--tRNA ligase, mitochondrial
13	9606.ENSP00000355889	0.891	Isoleucine--tRNA ligase, mitochondrial
14	9606.ENSP00000231572	0.887	Arginine--tRNA ligase, cytoplasmic
15	9606.ENSP00000262027	0.870	Methionine--tRNA ligase, cytoplasmic
16	9606.ENSP00000261772	0.868	Alanine--tRNA ligase, cytoplasmic
17	9606.ENSP00000325448	0.864	Lysine--tRNA ligase
18	9606.ENSP00000355086	0.862	Aspartate--tRNA ligase, mitochondrial
19	9606.ENSP00000360327	0.852	Probable proline--tRNA ligase, mitochondrial
20	9606.ENSP00000441000	0.844	Valine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004825	1.000	methionine-tRNA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006418	0.995	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.842	mitochondrial matrix
GO:0005829	0.387	cytosol
GO:0005654	0.324	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13481	1.000	ATP + L-methionine + tRNA(Met) = AMP + diphosphate + L-methionyl-tRNA(Met)
EC:6.1.1.10	1.000	methionine--tRNA ligase.

[back to server]