StarFunc result for job id Q96GX5

User Input

>input (879 residues)
MDPTAGSKKEPGGGAATEEGVNRIAVPKPPSIEEFSIVKPISRGAFGKVYLGQKGGKLYA
VKVVKKADMINKNMTHQVQAERDALALSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKS
LLHIYGYFDEEMAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLSKV
TLNRDINMMDILTTPSMAKPRQDYSRTPGQVLSLISSLGFNTPIAEKNQDPANILSACLS
ETSQLSQGLVCPMSVDQKDTTPYSSKLLKSCLETVASNPGMPVKCLTSNLLQSRKRLATS
SASSQSHTFISSVESECHSSPKWEKDCQESDEALGPTMMSWNAVEKLCAKSANAIETKGF
NKKDLELALSPIHNSSALPTTGRSCVNLAKKCFSGEVSWEAVELDVNNINMDTDTSQLGF
HQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQ
NTGLTVEVQDLKLSVHKSQQNDCANKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDC
EKNSKRDYLSSSFLCSDDDRASKNISMNSDSSFPGISIMESPLESQPLDSDRSIKESSFE
ESNIEDPLIVTPDCQEKTSPKGVENPAVQESNQKMLGPPLEVLKTLASKRNAVAFRSFNS
HINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQQTPNQIKSGTPY
RTPKSVRRGVAPVDDGRILGTPDYLAPELLLGRAHGPAVDWWALGVCLFEFLTGIPPFND
ETPQQVFQNILKRDIPWPEGEEKLSDNAQSAVEILLTIDDTKRAGMKELKRHPLFSDVDW
ENLQHQTMPFIPQPDDETDTSYFEARNTAQHLTVSGFSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96GX5	1.000	1.000	0.000	879	1.000	1.000	Q96GX5.pdb.gz	GWL_HUMAN Serine/threonine-protein kinase greatwall OS=Homo sapiens OX=9606 GN=MASTL PE=1 SV=1
2	AFDB:F1RVK2	0.473	0.475	1.981E-95	876	0.835	0.838	F1RVK2.pdb.gz	F1RVK2_PIG Microtubule associated serine/threonine kinase like OS=Sus scrofa OX=9823 GN=MASTL PE=4 SV=4
3	AFDB:Q8C0P0	0.557	0.566	3.418E-94	865	0.742	0.754	Q8C0P0.pdb.gz	GWL_MOUSE Serine/threonine-protein kinase greatwall OS=Mus musculus OX=10090 GN=Mastl PE=2 SV=2
4	AFDB:Q6NTJ3	0.530	0.526	1.401E-70	887	0.546	0.541	Q6NTJ3.pdb.gz	GWL_XENLA Serine/threonine-protein kinase greatwall OS=Xenopus laevis OX=8355 GN=mastl PE=1 SV=1
5	AFDB:Q6DBX4	0.430	0.439	1.097E-60	860	0.484	0.494	Q6DBX4.pdb.gz	GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio OX=7955 GN=mastl PE=2 SV=1
6	PDB:6byrA	0.174	0.374	3.848E-14	405	0.065	0.141	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
7	PDB:3pfqA	0.169	0.281	1.165E-13	523	0.074	0.124	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
8	PDB:3c4wB	0.171	0.287	2.708E-13	519	0.059	0.100	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
9	PDB:4c0tA	0.171	0.502	5.099E-13	291	0.056	0.168	4c0tA.pdb.gz
10	PDB:5x3fB	0.171	0.420	5.973E-13	349	0.063	0.158	5x3fB.pdb.gz
11	PDB:3pvuA	0.171	0.244	6.296E-13	609	0.060	0.087	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
12	PDB:4zhxA	0.167	0.353	6.296E-13	409	0.061	0.132	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
13	PDB:6b1uA	0.169	0.331	9.108E-13	442	0.053	0.106	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
14	PDB:4rerA	0.170	0.321	1.715E-12	459	0.052	0.100	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:3nynA	0.174	0.275	2.353E-12	554	0.058	0.092	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
16	AFDB:O54988	0.161	0.117	1.275E-10	1233	0.154	0.109	O54988.pdb.gz	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
17	AFDB:Q9W179	0.162	0.085	1.051E-9	1703	0.164	0.085	Q9W179.pdb.gz	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
18	AFDB:A0A024R8E2	0.155	0.121	2.360E-8	1130	0.147	0.114	A0A024R8E2.pdb.gz
19	AFDB:Q9JM52	0.154	0.106	2.403E-7	1308	0.150	0.101	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
20	AFDB:Q10925	0.148	0.106	7.022E-6	1237	0.147	0.104	Q10925.pdb.gz	SID3_CAEEL Tyrosine-protein kinase sid-3 OS=Caenorhabditis elegans OX=6239 GN=sid-3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WUU7	0.0	890	479	0.519	0.952	A0A087WUU7_HUMAN Microtubule associated serine/threonine kinase like (Fragment) OS=Homo sapiens OX=9606 GN=MASTL PE=1 SV=1
2	F1RVK2	0.0	1493	875	0.835	0.839	F1RVK2_PIG Microtubule associated serine/threonine kinase like OS=Sus scrofa OX=9823 GN=MASTL PE=4 SV=4
3	Q6DBX4	0.0	707	860	0.488	0.499	GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio OX=7955 GN=mastl PE=2 SV=1
4	Q6NTJ3	0.0	831	887	0.545	0.540	GWL_XENLA Serine/threonine-protein kinase greatwall OS=Xenopus laevis OX=8355 GN=mastl PE=1 SV=1
5	Q8C0P0	0.0	1298	865	0.749	0.761	GWL_MOUSE Serine/threonine-protein kinase greatwall OS=Mus musculus OX=10090 GN=Mastl PE=2 SV=2
6	Q96GX5	0.0	1831	879	1.000	1.000	GWL_HUMAN Serine/threonine-protein kinase greatwall OS=Homo sapiens OX=9606 GN=MASTL PE=1 SV=1
7	A0A0B4KGX7	4.63e-68	244	803	0.130	0.142	A0A0B4KGX7_DROME Greatwall, isoform B OS=Drosophila melanogaster OX=7227 GN=gwl PE=4 SV=1
8	Q95TN8	9.60e-68	244	846	0.130	0.135	Q95TN8_DROME Greatwall, isoform A OS=Drosophila melanogaster OX=7227 GN=gwl PE=2 SV=1
9	F4J6F6	8.77e-52	199	1296	0.108	0.073	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
10	Q9LE81	3.61e-51	197	1168	0.113	0.085	IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana OX=3702 GN=IRE PE=2 SV=1
11	F4HYG2	7.08e-49	190	1235	0.105	0.074	IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana OX=3702 GN=IRE3 PE=2 SV=1
12	Q8TFG6	6.53e-44	175	1318	0.102	0.068	PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk18 PE=3 SV=2
13	P38938	4.32e-43	172	1338	0.097	0.064	CEK1_SCHPO Serine/threonine-protein kinase cek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cek1 PE=1 SV=3
14	P43565	1.24e-41	168	1770	0.084	0.042	RIM15_YEAST Serine/threonine-protein kinase RIM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM15 PE=1 SV=1
15	Q5AP53	7.55e-41	163	732	0.088	0.105	CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CBK1 PE=1 SV=2
16	O13310	1.73e-39	155	469	0.093	0.175	ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orb6 PE=1 SV=1
17	Q9VA38	6.90e-39	159	1105	0.086	0.069	WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster OX=7227 GN=wts PE=1 SV=1
18	Q9NBK5	8.10e-39	153	463	0.091	0.173	TRC_DROME Serine/threonine-protein kinase tricornered OS=Drosophila melanogaster OX=7227 GN=trc PE=1 SV=1
19	Q9VUQ9	1.19e-38	159	2139	0.096	0.039	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
20	P38679	5.52e-38	153	598	0.083	0.122	COT1_NEUCR Serine/threonine-protein kinase cot-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=cot-1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.0047	27.6	ABC1 atypical kinase-like domain
2	PF01636 APH	7.2	17.9	Phosphotransferase enzyme family
3	PF13095 FTA2	27	15.9	Kinetochore Sim4 complex subunit FTA2
4	PF06293 Kdo	5.4	17.9	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	37	15.1	Kinase-like
6	PF00069 Pkinase	4.5e-55	198.4	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	7.7e-27	105.8	Protein tyrosine and serine/threonine kinase
8	PF01163 RIO1	2.4e+02	12.7	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365107

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341743	0.995	Alpha-endosulfine
2	9606.ENSP00000455625	0.994	cAMP-regulated phosphoprotein 19
3	9606.ENSP00000256442	0.985	G2/mitotic-specific cyclin-B1
4	9606.ENSP00000378699	0.962	Cyclin-dependent kinase 1
5	9606.ENSP00000399970	0.952	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
6	9606.ENSP00000300093	0.924	Serine/threonine-protein kinase PLK1
7	9606.ENSP00000356379	0.871	Abnormal spindle-like microcephaly-associated protein
8	9606.ENSP00000365210	0.863	G2/mitotic-specific cyclin-B3
9	9606.ENSP00000324804	0.842	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
10	9606.ENSP00000418447	0.823	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
11	9606.ENSP00000288207	0.819	G2/mitotic-specific cyclin-B2
12	9606.ENSP00000260731	0.801	Kinesin-like protein KIF11
13	9606.ENSP00000377036	0.792	Serine/threonine-protein phosphatase 2A activator
14	9606.ENSP00000372023	0.780	Serine/threonine-protein kinase Chk2
15	9606.ENSP00000311344	0.766	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
16	9606.ENSP00000415034	0.766	Neurobeachin-like protein 2
17	9606.ENSP00000274289	0.763	Serine/threonine-protein kinase PLK2
18	9606.ENSP00000221138	0.759	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
19	9606.ENSP00000325074	0.720	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
20	9606.ENSP00000302530	0.715	Mitotic checkpoint serine/threonine-protein kinase BUB1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0051174	0.955	regulation of phosphorus metabolic process
GO:0019220	0.928	regulation of phosphate metabolic process
GO:0048519	0.895	negative regulation of biological process
GO:0022402	0.893	cell cycle process
GO:0035303	0.891	regulation of dephosphorylation
GO:0031400	0.889	negative regulation of protein modification process
GO:0044092	0.869	negative regulation of molecular function
GO:0000278	0.854	mitotic cell cycle
GO:0044770	0.852	cell cycle phase transition
GO:0048523	0.846	negative regulation of cellular process
GO:0035304	0.826	regulation of protein dephosphorylation
GO:0044772	0.817	mitotic cell cycle phase transition
GO:0051726	0.811	regulation of cell cycle
GO:0035305	0.811	negative regulation of dephosphorylation
GO:0050790	0.765	regulation of catalytic activity
GO:0044839	0.702	cell cycle G2/M phase transition
GO:0043086	0.695	negative regulation of catalytic activity
GO:0051336	0.694	regulation of hydrolase activity
GO:0000086	0.687	G2/M transition of mitotic cell cycle
GO:0071840	0.682	cellular component organization or biogenesis
GO:0010921	0.654	regulation of phosphatase activity
GO:0016043	0.645	cellular component organization
GO:0044238	0.556	primary metabolic process
GO:0071704	0.555	organic substance metabolic process
GO:0051346	0.554	negative regulation of hydrolase activity
GO:0006807	0.545	nitrogen compound metabolic process
GO:0043666	0.545	regulation of phosphoprotein phosphatase activity
GO:0010923	0.543	negative regulation of phosphatase activity
GO:0044237	0.541	cellular metabolic process
GO:0006996	0.524	organelle organization
GO:0043170	0.513	macromolecule metabolic process
GO:0048518	0.511	positive regulation of biological process
GO:0035308	0.494	negative regulation of protein dephosphorylation
GO:0010564	0.493	regulation of cell cycle process
GO:0048522	0.445	positive regulation of cellular process
GO:0050896	0.337	response to stimulus
GO:0000280	0.327	nuclear division
GO:0019538	0.306	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0015630	0.969	microtubule cytoskeleton
GO:0005737	0.899	cytoplasm
GO:0016020	0.833	membrane
GO:0071944	0.810	cell periphery
GO:0005813	0.541	centrosome
GO:0005819	0.499	spindle
GO:0005829	0.427	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]