StarFunc result for job id Q96GX9

User Input

>input (242 residues)
MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAP
SGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKA
AVMATLLFPGREFKITHQEMIKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHA
MNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKVGLDPSQLPVGENG
IV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96GX9	1.000	1.000	5.725E-53	242	1.000	1.000	Q96GX9.pdb.gz	MTNB_HUMAN Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP PE=1 SV=1
2	PDB:4m6rA	0.924	0.999	1.984E-46	224	0.921	0.996	4m6rA.pdb.gz	Structural and biochemical basis for the inhibition of cell death by APIP, a methionine salvage enzyme.
3	AFDB:P47095	0.846	0.839	8.035E-29	244	0.430	0.426	P47095.pdb.gz	MTNB_YEAST Methylthioribulose-1-phosphate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDE1 PE=1 SV=1
4	AFDB:Q9FN41	0.828	0.401	5.815E-27	507	0.459	0.219	Q9FN41.pdb.gz	MTBC_ARATH Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Arabidopsis thaliana OX=3702 GN=At5g53850 PE=1 SV=1
5	AFDB:Q9HE08	0.827	0.876	1.369E-26	228	0.372	0.395	Q9HE08.pdb.gz	MTNB_SCHPO Methylthioribulose-1-phosphate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mde1 PE=3 SV=2
6	AFDB:P0DTQ0	0.695	0.783	5.140E-13	213	0.198	0.225	P0DTQ0.pdb.gz	DRDA_BACT7 5-deoxy-D-ribulose 1-phosphate aldolase OS=Bacillus thuringiensis serovar kurstaki (strain ATCC 35866 / NRRL B-4488 / HD73) OX=1279365 GN=drdA PE=1 SV=1
7	PDB:2fuaA	0.695	0.792	3.680E-12	210	0.190	0.219	2fuaA.pdb.gz	Refined high-resolution structure of the metal-ion dependent L-fuculose-1-phosphate aldolase (class II) from Escherichia coli.
8	AFDB:Q58813	0.633	0.829	4.372E-12	181	0.165	0.221	Q58813.pdb.gz	FUCA_METJA L-fuculose phosphate aldolase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=fucA PE=1 SV=1
9	AFDB:P0AB87	0.699	0.779	5.253E-12	215	0.194	0.219	P0AB87.pdb.gz	FUCA_ECOLI L-fuculose phosphate aldolase OS=Escherichia coli (strain K12) OX=83333 GN=fucA PE=1 SV=1
10	PDB:1jdiA	0.687	0.741	3.130E-11	223	0.194	0.211	1jdiA.pdb.gz	The structure of L-ribulose-5-phosphate 4-epimerase: an aldolase-like platform for epimerization.
11	AFDB:P08203	0.679	0.709	7.289E-11	231	0.186	0.195	P08203.pdb.gz	ARAD_ECOLI L-ribulose-5-phosphate 4-epimerase AraD OS=Escherichia coli (strain K12) OX=83333 GN=araD PE=1 SV=2
12	AFDB:P37680	0.654	0.682	1.519E-10	231	0.194	0.203	P37680.pdb.gz	SGBE_ECOLI L-ribulose-5-phosphate 4-epimerase SgbE OS=Escherichia coli (strain K12) OX=83333 GN=sgbE PE=1 SV=1
13	AFDB:P39306	0.664	0.700	2.800E-10	228	0.169	0.180	P39306.pdb.gz	ULAF_ECOLI L-ribulose-5-phosphate 4-epimerase UlaF OS=Escherichia coli (strain K12) OX=83333 GN=ulaF PE=1 SV=1
14	PDB:2z7bA	0.608	0.620	2.957E-8	237	0.182	0.186	2z7bA.pdb.gz	Gene Identification and Structural Characterization of the Pyridoxal 5'-Phosphate Degradative Protein 3-Hydroxy-2-methylpyridine-4,5-dicarboxylate Decarboxylase from Mesorhizobium loti MAFF303099
15	PDB:1gt7A	0.618	0.551	6.053E-6	274	0.132	0.117	1gt7A.pdb.gz	The Structure of L-Rhamnulose-1-Phosphate Aldolase (Class II) Solved by Low-Resolution Sir Phasing and 20-Fold Ncs Averaging
16	PDB:2lxxA	0.089	0.116	1.170	152	0.050	0.079	2lxxA.pdb.gz
17	PDB:2o5vA	0.125	0.090	1.323	358	0.087	0.059	2o5vA.pdb.gz
18	PDB:4f5fB	0.172	0.115	1.495	400	0.037	0.022	4f5fB.pdb.gz
19	PDB:5svkA	0.077	0.055	1.589	357	0.050	0.034	5svkA.pdb.gz	X-ray structures define human P2X3 receptor gating cycle and antagonist action.
20	PDB:1nyeD	0.124	0.169	2.157	162	0.054	0.080	1nyeD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96GX9	0.0	508	242	1.000	1.000	MTNB_HUMAN Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP PE=1 SV=1
2	Q9WVQ5	4.66e-174	480	241	0.942	0.946	MTNB_MOUSE Methylthioribulose-1-phosphate dehydratase OS=Mus musculus OX=10090 GN=Apip PE=1 SV=1
3	Q9FN41	2.83e-64	209	507	0.463	0.221	MTBC_ARATH Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Arabidopsis thaliana OX=3702 GN=At5g53850 PE=1 SV=1
4	P47095	1.02e-60	193	244	0.434	0.430	MTNB_YEAST Methylthioribulose-1-phosphate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDE1 PE=1 SV=1
5	Q9HE08	3.22e-57	183	228	0.397	0.421	MTNB_SCHPO Methylthioribulose-1-phosphate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mde1 PE=3 SV=2
6	Q58813	3.10e-08	54.3	181	0.186	0.249	FUCA_METJA L-fuculose phosphate aldolase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=fucA PE=1 SV=1
7	P0AB87	2.35e-05	46.2	215	0.116	0.130	FUCA_ECOLI L-fuculose phosphate aldolase OS=Escherichia coli (strain K12) OX=83333 GN=fucA PE=1 SV=1
8	P37680	1.45e-04	43.9	231	0.236	0.247	SGBE_ECOLI L-ribulose-5-phosphate 4-epimerase SgbE OS=Escherichia coli (strain K12) OX=83333 GN=sgbE PE=1 SV=1
9	P0DTQ0	2.45e-04	43.1	213	0.227	0.258	DRDA_BACT7 5-deoxy-D-ribulose 1-phosphate aldolase OS=Bacillus thuringiensis serovar kurstaki (strain ATCC 35866 / NRRL B-4488 / HD73) OX=1279365 GN=drdA PE=1 SV=1
10	Q5VU08	0.032	37.7	706	0.186	0.064	Q5VU08_HUMAN Adducin 3 (Gamma), isoform CRA_a OS=Homo sapiens OX=9606 GN=ADD3 PE=2 SV=1
11	Q9UEY8	0.032	37.7	706	0.186	0.064	ADDG_HUMAN Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1
12	Q62847	0.13	35.8	705	0.190	0.065	ADDG_RAT Gamma-adducin OS=Rattus norvegicus OX=10116 GN=Add3 PE=1 SV=3
13	Q57X95	0.36	33.9	258	0.116	0.109	Q57X95_TRYB2 Proteasome subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.340 PE=3 SV=1
14	P08203	0.43	33.5	231	0.198	0.208	ARAD_ECOLI L-ribulose-5-phosphate 4-epimerase AraD OS=Escherichia coli (strain K12) OX=83333 GN=araD PE=1 SV=2
15	Q9QYB5	1.0	33.1	706	0.182	0.062	ADDG_MOUSE Gamma-adducin OS=Mus musculus OX=10090 GN=Add3 PE=1 SV=2
16	A0A140LI88	1.5	32.7	1857	0.070	0.009	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
17	H8ESE4	2.0	32.3	1138	0.066	0.014	H8ESE4_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
18	H7BRC9	2.1	32.0	1160	0.066	0.014	H7BRC9_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
19	H7BRM4	2.1	32.0	1153	0.066	0.014	H7BRM4_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
20	H7BRM5	2.2	32.0	1118	0.066	0.014	H7BRM5_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00596 Aldolase_II	8.4e-45	164.4	Class II Aldolase and Adducin N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021779

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010628	0.999	Enolase-phosphatase E1
2	61853.ENSNLEP00000015925	0.996	Methylthioribose-1-phosphate isomerase
3	61853.ENSNLEP00000009145	0.929	Catalyzes the formation of formate and 2-keto-4- methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14.
4	61853.ENSNLEP00000007362	0.882	Apoptotic protease-activating factor 1
5	61853.ENSNLEP00000004008	0.685	Lysophosphatidic acid receptor 6
6	61853.ENSNLEP00000021243	0.674	S-methyl-5'-thioadenosine phosphorylase
7	61853.ENSNLEP00000021782	0.667	Pyruvate dehydrogenase complex, component X
8	61853.ENSNLEP00000019203	0.615	Phosphatidylethanolamine-binding protein 4
9	61853.ENSNLEP00000021777	0.567	Ets homologous factor
10	61853.ENSNLEP00000009264	0.550	Caspase 9, apoptosis-related cysteine peptidase
11	61853.ENSNLEP00000010469	0.547	Ciliogenesis associated TTC17 interacting protein
12	61853.ENSNLEP00000021615	0.545	Palmitoyltransferase
13	61853.ENSNLEP00000007652	0.533	Synaptotagmin XII
14	61853.ENSNLEP00000006536	0.531	Xylulokinase homolog (H. influenzae)
15	61853.ENSNLEP00000004449	0.521	NFKB inhibitor epsilon
16	61853.ENSNLEP00000005909	0.514	Triosephosphate isomerase 1
17	61853.ENSNLEP00000012692	0.512	Dynactin 4 (p62)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0016836	1.000	hydro-lyase activity
GO:0008270	1.000	zinc ion binding
GO:0046570	0.977	methylthioribulose 1-phosphate dehydratase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008219	0.990	cell death
GO:0043069	0.990	negative regulation of programmed cell death
GO:0071704	0.986	organic substance metabolic process
GO:0042981	0.985	regulation of apoptotic process
GO:0044238	0.983	primary metabolic process
GO:0044237	0.977	cellular metabolic process
GO:0006807	0.976	nitrogen compound metabolic process
GO:1901564	0.945	organonitrogen compound metabolic process
GO:0012501	0.870	programmed cell death
GO:0044281	0.763	small molecule metabolic process
GO:1901576	0.655	organic substance biosynthetic process
GO:1901566	0.625	organonitrogen compound biosynthetic process
GO:0044249	0.575	cellular biosynthetic process
GO:0043066	0.415	negative regulation of apoptotic process
GO:0019752	0.379	carboxylic acid metabolic process
GO:0006790	0.318	sulfur compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.946	intracellular membrane-bounded organelle
GO:0005634	0.725	nucleus
GO:0043233	0.429	organelle lumen
GO:0070013	0.418	intracellular organelle lumen
GO:0005654	0.383	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.2.1.-	1.000	Hydro-lyases.
RHEA:15549	0.977	S-methyl-5-thio-D-ribulose 1-phosphate = 5-methylsulfanyl-2,3-dioxopentyl phosphate + H2O
EC:4.2.1.109	0.977	methylthioribulose 1-phosphate dehydratase.

[back to server]