StarFunc result for job id Q96H55

User Input

>input (970 residues)
MLQQVNGHNPGSDGQAREYLREDLQEFLGGEVLLYKLDDLTRVNPVTLETVLRCLQARYM
ADTFYTNAGCTLVALNPFKPVPQLYSPELMREYHAAPQPQKLKPHVFTVGEQTYRNVKSL
IEPVNQSIVVSGESGAGKTWTSRCLMKFYAVVATSPASWESHKIAERIEQRILNSNPVME
AFGNACTLRNNNSSRFGKFIQLQLNRAQQMTGAAVQTYLLEKTRVACQASSERNFHIFYQ
ICKGASEDERLQWHLPEGAAFSWLPNPERSLEEDCFEVTREAMLHLGIDTPTQNNIFKVL
AGLLHLGNIQFAASEDEAQPCQPMDDAKYSVRTAASLLGLPEDVLLEMVQIRTIRAGRQQ
QVFRKPCARAECDTRRDCLAKLIYARLFDWLVSVINSSICADTDSWTTFIGLLDVYGFES
FPDNSLEQLCINYANEKLQQHFVAHYLRAQQEEYAVEGLEWSFINYQDNQPCLDLIEGSP
ISICSLINEECRLNRPSSAAQLQTRIETALAGSPCLGHNKLSREPSFIVVHYAGPVRYHT
AGLVEKNKDPIPPELTRLLQQSQDPLLMGLFPTNPKEKTQEEPPGQSRAPVLTVVSKFKA
SLEQLLQVLHSTTPHYIRCIKPNSQGQAQTFLQEEVLSQLEACGLVETIHISAAGFPIRV
SHRNFVERYKLLRRLHPCTSSGPDSPYPAKGLPEWCPHSEEATLEPLIQDILHTLPVLTQ
AAAITGDSAEAMPAPMHCGRTKVFMTDSMLELLECGRARVLEQCARCIQGGWRRHRHREQ
ERQWRAVMLIQAAIRSWLTRKHIQRLHAAATVIKRAWQKWRIRMACLAAKELDGVEEKHF
SQAPCSLSTSPLQTRLLEAIIRLWPLGLVLANTAMGVGSFQRKLVVWACLQLPRGSPSSY
TVQTAQDQAGVTSIRALPQGSIKFHCRKSPLRYADICPEPSPYSITGFNQILLERHRLIH
VTSSAFTGLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B4E218	0.714	0.714	0.000	970	0.997	0.997	B4E218.pdb.gz	B4E218_HUMAN cDNA FLJ61052, highly similar to Homo sapiens myosin head domain containing 1 (MYOHD1), transcript variant 2, mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q5SV80	0.862	0.868	0.000	963	0.816	0.822	Q5SV80.pdb.gz	MYO19_MOUSE Unconventional myosin-XIX OS=Mus musculus OX=10090 GN=Myo19 PE=1 SV=1
3	AFDB:O94477	0.658	0.429	1.944E-61	1516	0.300	0.192	O94477.pdb.gz	MYO52_SCHPO Myosin-52 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo52 PE=1 SV=1
4	AFDB:Q99MZ6	0.652	0.307	4.969E-61	2113	0.296	0.136	Q99MZ6.pdb.gz	MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus OX=10090 GN=Myo7b PE=1 SV=3
5	AFDB:Q0WPU1	0.611	0.397	1.682E-60	1522	0.304	0.194	Q0WPU1.pdb.gz	MYO15_ARATH Myosin-15 OS=Arabidopsis thaliana OX=3702 GN=XI-I PE=1 SV=1
6	AFDB:Q9U1M8	0.665	0.285	8.690E-60	2357	0.315	0.130	Q9U1M8.pdb.gz	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1
7	AFDB:F4IUG9	0.609	0.402	1.000E-59	1493	0.301	0.196	F4IUG9.pdb.gz	MYO13_ARATH Myosin-13 OS=Arabidopsis thaliana OX=3702 GN=XI-G PE=3 SV=1
8	AFDB:P91443	0.654	0.310	1.456E-59	2098	0.287	0.133	P91443.pdb.gz	HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans OX=6239 GN=hum-6 PE=1 SV=1
9	AFDB:Q39160	0.617	0.402	1.456E-59	1520	0.294	0.188	Q39160.pdb.gz	MYO5_ARATH Myosin-5 OS=Arabidopsis thaliana OX=3702 GN=XI-1 PE=1 SV=1
10	AFDB:Q9LKB9	0.613	0.403	1.456E-59	1505	0.302	0.195	Q9LKB9.pdb.gz	MYO6_ARATH Myosin-6 OS=Arabidopsis thaliana OX=3702 GN=XI-2 PE=1 SV=1
11	PDB:4anjA	0.590	0.576	1.368E-48	995	0.253	0.246	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
12	PDB:4pa0A	0.565	0.563	6.408E-47	974	0.231	0.230	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.567	0.595	1.563E-46	920	0.231	0.243	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:6ycxB	0.611	0.718	2.498E-46	817	0.218	0.258	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
15	PDB:4p7hB	0.567	0.577	6.637E-44	952	0.228	0.232	4p7hB.pdb.gz
16	PDB:7mf3B	0.612	0.659	3.551E-40	896	0.259	0.280	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.566	0.575	3.208E-38	954	0.259	0.263	5tbyA.pdb.gz
18	PDB:3gjxA	0.070	0.067	1.310E-1	1041	0.062	0.058	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
19	PDB:6wxuB	0.063	0.174	3.049E-1	273	0.022	0.077	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
20	PDB:7d3eB	0.042	0.092	9.399E-1	272	0.022	0.077	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4E218	0.0	2011	970	0.998	0.998	B4E218_HUMAN cDNA FLJ61052, highly similar to Homo sapiens myosin head domain containing 1 (MYOHD1), transcript variant 2, mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q5SV80	0.0	1633	963	0.816	0.822	MYO19_MOUSE Unconventional myosin-XIX OS=Mus musculus OX=10090 GN=Myo19 PE=1 SV=1
3	Q96H55	0.0	2015	970	1.000	1.000	MYO19_HUMAN Unconventional myosin-XIX OS=Homo sapiens OX=9606 GN=MYO19 PE=1 SV=2
4	O94477	9.79e-148	478	1516	0.300	0.192	MYO52_SCHPO Myosin-52 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo52 PE=1 SV=1
5	Q0WPU1	2.03e-147	477	1522	0.300	0.191	MYO15_ARATH Myosin-15 OS=Arabidopsis thaliana OX=3702 GN=XI-I PE=1 SV=1
6	F4HXP9	2.22e-146	475	1538	0.302	0.191	MYO9_ARATH Myosin-9 OS=Arabidopsis thaliana OX=3702 GN=XI-C PE=2 SV=1
7	Q5AKW2	2.33e-146	475	1561	0.311	0.193	Q5AKW2_CANAL Myosin 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO2 PE=3 SV=1
8	F4HWY6	1.09e-145	473	1529	0.302	0.192	MYO11_ARATH Myosin-11 OS=Arabidopsis thaliana OX=3702 GN=XI-E PE=3 SV=1
9	P32492	1.15e-145	472	1471	0.322	0.212	MYO4_YEAST Myosin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO4 PE=1 SV=1
10	Q9LKB9	1.51e-144	469	1505	0.307	0.198	MYO6_ARATH Myosin-6 OS=Arabidopsis thaliana OX=3702 GN=XI-2 PE=1 SV=1
11	Q5AS68	1.71e-144	470	1569	0.306	0.189	Q5AS68_EMENI Aspergillus nidulans myosin V homolog (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08862 PE=3 SV=1
12	F4K7C5	3.50e-144	469	1565	0.307	0.190	F4K7C5_ARATH Myosin 2 OS=Arabidopsis thaliana OX=3702 GN=MYA2 PE=1 SV=1
13	P19524	1.33e-143	468	1574	0.300	0.185	MYO2_YEAST Myosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO2 PE=1 SV=1
14	O74805	2.38e-143	465	1471	0.298	0.196	MYO51_SCHPO Myosin-51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo51 PE=3 SV=1
15	F4JM19	1.29e-142	464	1516	0.305	0.195	MYO14_ARATH Myosin-14 OS=Arabidopsis thaliana OX=3702 GN=XI-H PE=3 SV=1
16	F4IUG9	5.02e-142	462	1493	0.310	0.202	MYO13_ARATH Myosin-13 OS=Arabidopsis thaliana OX=3702 GN=XI-G PE=3 SV=1
17	F4I460	6.06e-142	462	1500	0.303	0.196	MYO8_ARATH Myosin-8 OS=Arabidopsis thaliana OX=3702 GN=XI-B PE=3 SV=1
18	F4IVR7	8.72e-141	463	1770	0.304	0.167	MYO10_ARATH Myosin-10 OS=Arabidopsis thaliana OX=3702 GN=XI-D PE=3 SV=1
19	B0CN59	8.86e-141	459	1512	0.314	0.202	B0CN59_NICBE Myosin XI-2 OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
20	F4IRU3	1.02e-140	460	1556	0.299	0.186	MYO12_ARATH Myosin-12 OS=Arabidopsis thaliana OX=3702 GN=XI-F PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	3.4	19.5	AAA ATPase domain
2	PF13401 AAA_22	12	17.6	AAA domain
3	PF00612 IQ	3.6	18.6	IQ calmodulin-binding motif
4	PF00063 Myosin_head	3.8e-190	645.2	Myosin head (motor domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479518

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321971	0.815	Mitochondrial Rho GTPase 2
2	9606.ENSP00000307636	0.756	MORN repeat-containing protein 4
3	9606.ENSP00000328998	0.684	Trafficking kinesin-binding protein 1
4	9606.ENSP00000351132	0.637	Mitochondrial Rho GTPase 1
5	9606.ENSP00000341625	0.634	Cytochrome b5
6	9606.ENSP00000328875	0.619	Trafficking kinesin-binding protein 2
7	9606.ENSP00000482704	0.615	Dehydrogenase/reductase SDR family member 11
8	9606.ENSP00000481559	0.612	rRNA methyltransferase 1, mitochondrial
9	9606.ENSP00000307078	0.606	Kinesin-1 heavy chain
10	9606.ENSP00000484687	0.604	Zinc finger HIT-type containing 3
11	9606.ENSP00000478220	0.603	Gametogenetin-binding protein 2
12	9606.ENSP00000478886	0.602	Uncharacterized protein C17orf78
13	9606.ENSP00000481091	0.582	Transcriptional adapter 2-alpha
14	9606.ENSP00000403910	0.576	Distal membrane-arm assembly complex protein 2
15	9606.ENSP00000483453	0.567	Synergin gamma
16	9606.ENSP00000393379	0.566	Kinesin heavy chain isoform 5C
17	9606.ENSP00000479504	0.562	Probable ATP-dependent RNA helicase DDX52
18	9606.ENSP00000482202	0.561	Phosphatidylinositol-glycan biosynthesis class W protein
19	9606.ENSP00000223167	0.546	Myosin regulatory light chain 10
20	9606.ENSP00000437073	0.531	Unconventional myosin-XVIIIa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.999	cytoskeletal protein binding
GO:0016887	0.999	ATP hydrolysis activity
GO:0003774	0.998	cytoskeletal motor activity
GO:0000146	0.985	microfilament motor activity
GO:0003779	0.911	actin binding
GO:0097159	0.601	organic cyclic compound binding
GO:1901363	0.599	heterocyclic compound binding
GO:0043167	0.495	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0051640	0.988	organelle localization
GO:0051234	0.988	establishment of localization
GO:0051656	0.978	establishment of organelle localization
GO:0051654	0.974	establishment of mitochondrion localization
GO:0065007	0.906	biological regulation
GO:0050789	0.902	regulation of biological process
GO:0050794	0.872	regulation of cellular process
GO:0071840	0.749	cellular component organization or biogenesis
GO:0006810	0.748	transport
GO:0016043	0.674	cellular component organization
GO:0006996	0.614	organelle organization
GO:0030029	0.442	actin filament-based process
GO:0051128	0.322	regulation of cellular component organization
GO:0051641	0.310	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.948	membrane
GO:0005829	0.866	cytosol
GO:0031090	0.438	organelle membrane
GO:0043232	0.390	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.999	ATP + H2O = ADP + H(+) + phosphate
EC:5.6.1.8	0.985	myosin ATPase.

[back to server]