StarFunc result for job id Q96H78

User Input

>input (314 residues)
MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDA
FIKILRADGITGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSAS
LVAQSITVPIDVVSQHLMMQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLR
GFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSYLCPKECPHIVFQAVSGPLAAATASILT
NPMDVIRTRVQVEGKNSIILTFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLK
KLSLRPELVDSRHW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BGF9	0.990	0.990	7.236E-43	314	0.962	0.962	Q8BGF9.pdb.gz	S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus OX=10090 GN=Slc25a44 PE=1 SV=1
2	AFDB:Q949U9	0.798	0.777	8.290E-18	323	0.325	0.316	Q949U9.pdb.gz	Q949U9_ARATH Mitochondrial substrate carrier family protein OS=Arabidopsis thaliana OX=3702 GN=At5g15640 PE=1 SV=1
3	AFDB:Q5AL11	0.747	0.342	6.368E-14	731	0.290	0.124	Q5AL11.pdb.gz	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
4	AFDB:O64731	0.771	0.735	6.662E-14	331	0.226	0.215	O64731.pdb.gz	O64731_ARATH Mitochondrial substrate carrier family protein OS=Arabidopsis thaliana OX=3702 GN=MIT1 PE=1 SV=1
5	AFDB:Q8L6Z2	0.761	0.735	8.351E-14	326	0.232	0.224	Q8L6Z2.pdb.gz	Q8L6Z2_ARATH At1g07030 OS=Arabidopsis thaliana OX=3702 GN=MIT2 PE=1 SV=1
6	AFDB:Q38DS0	0.731	0.747	1.970E-13	307	0.239	0.244	Q38DS0.pdb.gz	Q38DS0_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2370 PE=3 SV=1
7	AFDB:Q9H1K4	0.719	0.717	1.970E-13	315	0.252	0.251	Q9H1K4.pdb.gz	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
8	AFDB:Q8BL03	0.719	0.737	2.959E-13	306	0.217	0.222	Q8BL03.pdb.gz	S2529_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus OX=10090 GN=Slc25a29 PE=1 SV=1
9	AFDB:Q12482	0.746	0.281	3.545E-13	902	0.242	0.084	Q12482.pdb.gz	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
10	AFDB:A0A0G2K5L2	0.729	0.711	4.060E-13	323	0.252	0.245	A0A0G2K5L2.pdb.gz	GHC1_RAT Mitochondrial glutamate carrier 1 OS=Rattus norvegicus OX=10116 GN=Slc25a22 PE=2 SV=1
11	PDB:4c9qB	0.679	0.730	1.210E-8	290	0.175	0.190	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.670	0.713	2.177E-8	293	0.204	0.218	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.499	0.529	8.099E-6	292	0.210	0.226	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:7xz5R	0.140	0.147	2.107E-1	292	0.143	0.154	7xz5R.pdb.gz	Structural identification of lysophosphatidylcholines as activating ligands for orphan receptor GPR119.
15	PDB:7td3R	0.163	0.171	3.624E-1	292	0.108	0.116	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
16	PDB:1w07B	0.133	0.080	5.957E-1	658	0.124	0.059	1w07B.pdb.gz	Acyl-Coa Oxidase 1 from Arabidopsis Thaliana. Structure of a Key Enzyme in Plant Lipid Metabolism
17	PDB:4pb1A	0.152	0.127	6.521E-1	404	0.134	0.104	4pb1A.pdb.gz	Structural basis of nucleoside and nucleoside drug selectivity by concentrative nucleoside transporters.
18	PDB:6osaR	0.160	0.157	7.138E-1	321	0.134	0.131	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
19	PDB:3b9yA	0.160	0.142	7.467E-1	388	0.140	0.113	3b9yA.pdb.gz
20	PDB:5nbdA	0.166	0.105	7.467E-1	564	0.140	0.078	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BGF9	0.0	632	314	0.962	0.962	S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus OX=10090 GN=Slc25a44 PE=1 SV=1
2	Q96H78	0.0	651	314	1.000	1.000	S2544_HUMAN Solute carrier family 25 member 44 OS=Homo sapiens OX=9606 GN=SLC25A44 PE=2 SV=1
3	Q949U9	1.87e-47	164	323	0.334	0.325	Q949U9_ARATH Mitochondrial substrate carrier family protein OS=Arabidopsis thaliana OX=3702 GN=At5g15640 PE=1 SV=1
4	Q9DB41	2.22e-26	108	320	0.261	0.256	GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus OX=10090 GN=Slc25a18 PE=1 SV=4
5	Q9QXX4	4.24e-26	110	676	0.268	0.124	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
6	F1LX07	6.55e-26	110	676	0.277	0.129	S2512_RAT Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a12 PE=3 SV=5
7	Q9UJS0	1.53e-25	108	675	0.268	0.124	S2513_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2
8	Q9H1K4	1.56e-25	105	315	0.252	0.251	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
9	O75746	2.25e-25	108	678	0.271	0.125	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
10	Q9VA73	3.95e-25	107	695	0.264	0.119	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
11	Q8BH59	5.06e-25	107	677	0.274	0.127	S2512_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1
12	Q5AL11	6.23e-25	107	731	0.296	0.127	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
13	Q505J6	2.38e-23	99.8	320	0.252	0.247	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
14	Q12482	4.86e-23	101	902	0.239	0.083	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
15	Q6GQS1	1.60e-20	93.6	467	0.223	0.150	SCMC3_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Mus musculus OX=10090 GN=Slc25a23 PE=1 SV=1
16	Q9FHX2	2.53e-20	92.8	412	0.226	0.172	MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MFL1 PE=2 SV=1
17	A2ASZ8	3.64e-20	92.8	469	0.220	0.147	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
18	Q9FI43	6.66e-20	92.0	487	0.242	0.156	MAPC2_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
19	Q9D8K8	6.92e-20	90.9	359	0.220	0.192	S2539_MOUSE Probable mitochondrial glutathione transporter SLC25A39 OS=Mus musculus OX=10090 GN=Slc25a39 PE=2 SV=1
20	Q9BV35	2.21e-19	90.5	468	0.223	0.150	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00473 CRF	3.1	19.3	Corticotropin-releasing factor family
2	PF00153 Mito_carr	1.4e-47	170.9	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003821118.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008969928.1	0.779	Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors.
2	9597.XP_008972802.1	0.659	Bone gamma-carboxyglutamate protein
3	9597.XP_003816625.1	0.653	Transmembrane protein 150A
4	9597.XP_003833259.1	0.653	Ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative)
5	9597.XP_003819782.1	0.641	Mitotic spindle assembly checkpoint protein MAD1 isoform X1
6	9597.XP_003821123.1	0.567	Belongs to the semaphorin family.
7	9597.XP_003832014.1	0.555	39S ribosomal protein L47, mitochondrial
8	9597.XP_003806334.1	0.541	Tripartite motif containing 45
9	9597.XP_008950944.1	0.541	RNA-binding E3 ubiquitin-protein ligase MEX3C
10	9597.XP_003823350.1	0.534	Golgin A7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008514	1.000	organic anion transmembrane transporter activity
GO:0015658	0.991	branched-chain amino acid transmembrane transporter activity
GO:0005488	0.930	binding
GO:0005515	0.775	protein binding
GO:0015605	0.428	organophosphate ester transmembrane transporter activity
GO:1901702	0.353	salt transmembrane transporter activity
GO:0015215	0.310	nucleotide transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0009063	0.986	amino acid catabolic process
GO:0009083	0.981	branched-chain amino acid catabolic process
GO:0051179	0.849	localization
GO:0051234	0.805	establishment of localization
GO:0065007	0.767	biological regulation
GO:0050789	0.711	regulation of biological process
GO:0006810	0.584	transport
GO:0050794	0.432	regulation of cellular process
GO:0050896	0.334	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031090	0.995	organelle membrane
GO:0019866	0.989	organelle inner membrane
GO:0031966	0.988	mitochondrial membrane
GO:0005743	0.958	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]