StarFunc result for job id Q96H86

User Input

>input (408 residues)
MAPPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALYRDVMRETYG
HLSALGIGGNKPALISWVEEEAELWGPAAQDPEVAKCQTQTDPADSRNKKKERQREGTGA
LEKPDPVAAGSPGLKSPQAPSAGPPYGWEQLSKAPHRGRPSLCAHPPVPRADQRHGCYVC
GKSFAWRSTLVEHVYSHTGEKPFHCTDCGKGFGHASSLSKHRAIHRGERPHRCLECGRAF
TQRSALTSHLRVHTGEKPYGCADCGRRFSQSSALYQHRRVHSGETPFPCPDCGRAFAYPS
DLRRHVRTHTGEKPYPCPDCGRCFRQSSEMAAHRRTHSGEKPYPCPQCGRRFGQKSAVAK
HQWVHRPGAGGHRGRVAGRLSVTLTPGHGDLDPPVGFQLYPEIFQECG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96H86	1.000	1.000	2.170E-70	408	1.000	1.000	Q96H86.pdb.gz	ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens OX=9606 GN=ZNF764 PE=1 SV=2
2	AFDB:A8K8V0	0.396	0.399	1.650E-32	405	0.426	0.430	A8K8V0.pdb.gz	ZN785_HUMAN Zinc finger protein 785 OS=Homo sapiens OX=9606 GN=ZNF785 PE=1 SV=1
3	AFDB:Q8BKK5	0.515	0.428	1.130E-31	500	0.429	0.350	Q8BKK5.pdb.gz	ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus OX=10090 GN=Znf689 PE=2 SV=1
4	AFDB:Q6PK81	0.429	0.398	1.426E-31	442	0.341	0.314	Q6PK81.pdb.gz	ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens OX=9606 GN=ZNF773 PE=1 SV=1
5	AFDB:P15622	0.452	0.339	8.694E-31	560	0.365	0.266	P15622.pdb.gz	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
6	AFDB:Q96JC4	0.446	0.353	1.651E-30	524	0.350	0.273	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
7	AFDB:Q96JL9	0.266	0.171	1.651E-30	665	0.363	0.223	Q96JL9.pdb.gz	ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=1 SV=3
8	AFDB:Q96HQ0	0.393	0.323	2.210E-30	510	0.343	0.275	Q96HQ0.pdb.gz	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
9	AFDB:Q8N9F8	0.301	0.238	2.790E-30	522	0.363	0.284	Q8N9F8.pdb.gz	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
10	AFDB:Q3USU9	0.399	0.270	2.958E-30	632	0.375	0.242	Q3USU9.pdb.gz	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
11	PDB:3w5kB	0.115	0.285	5.087E-5	110	0.108	0.400	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.042	0.193	3.388E-1	62	0.042	0.274	6ydhA.pdb.gz
13	PDB:5c8dE	0.093	0.104	1.543	280	0.056	0.082	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
14	PDB:6lss7	0.089	0.164	1.734	135	0.042	0.126	6lss7.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
15	PDB:7uhyC	0.051	0.038	2.065	578	0.037	0.026	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:6yxyAo	0.070	0.104	2.321	184	0.066	0.147	6yxyAo.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
17	PDB:7nacm	0.060	0.042	2.321	666	0.100	0.062	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
18	PDB:7o4iW	0.057	0.069	2.460	312	0.054	0.071	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:8ap8d	0.096	0.131	2.460	270	0.064	0.096	8ap8d.pdb.gz
20	PDB:4kfzB	0.074	0.161	2.608	148	0.064	0.176	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96H86	0.0	829	408	1.000	1.000	ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens OX=9606 GN=ZNF764 PE=1 SV=2
2	Q9BV97	1.65e-155	444	330	0.547	0.676	ZN747_HUMAN Zinc finger protein 747 OS=Homo sapiens OX=9606 GN=ZNF747 PE=1 SV=2
3	A8K8V0	1.27e-112	337	405	0.490	0.494	ZN785_HUMAN Zinc finger protein 785 OS=Homo sapiens OX=9606 GN=ZNF785 PE=1 SV=1
4	Q8BKK5	1.04e-97	302	500	0.458	0.374	ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus OX=10090 GN=Znf689 PE=2 SV=1
5	Q03936	5.37e-86	275	586	0.353	0.246	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
6	P17023	1.13e-85	270	458	0.350	0.312	ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens OX=9606 GN=ZNF19 PE=1 SV=4
7	Q8NCK3	1.88e-85	269	441	0.343	0.317	ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens OX=9606 GN=ZNF485 PE=1 SV=1
8	Q8N988	3.36e-85	268	423	0.365	0.352	ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens OX=9606 GN=ZNF557 PE=1 SV=2
9	Q03923	2.84e-84	270	595	0.348	0.239	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
10	Q8NA42	5.25e-84	266	475	0.363	0.312	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
11	Q8IYX0	1.29e-82	260	411	0.360	0.358	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
12	Q86U76	4.55e-82	259	410	0.358	0.356	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
13	Q9C0F3	4.71e-82	261	470	0.333	0.289	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
14	A0A0C4DG42	6.95e-82	263	539	0.395	0.299	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
15	P17036	8.83e-82	259	446	0.360	0.330	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
16	Q96NG5	1.66e-81	257	402	0.355	0.361	ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens OX=9606 GN=ZNF558 PE=1 SV=1
17	P52738	5.91e-81	258	457	0.346	0.309	ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens OX=9606 GN=ZNF140 PE=1 SV=2
18	Q3V362	1.21e-80	261	622	0.377	0.248	Q3V362_MOUSE Zinc finger protein 251 (Fragment) OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
19	Q3USU9	1.90e-80	261	632	0.377	0.244	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
20	Q6PCX8	1.98e-80	261	632	0.377	0.244	Q6PCX8_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07754 HVO_2753_ZBP	26	16.0	Small zinc finger protein HVO_2753-like, Zn-binding pocket
2	PF01155 HypA	5.8	18.4	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
3	PF01352 KRAB	4.1e-17	72.8	KRAB box
4	PF00096 zf-C2H2	2.6e-33	123.8	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	1.5e-08	45.6	zinc-finger C2H2-type
6	PF13894 zf-C2H2_4	5.3e-19	78.3	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	0.0081	27.4	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	0.0043	28.5	Zinc-finger double-stranded RNA-binding
9	PF16278 zf-C2HE	3e+02	13.3	C2HE / C2H2 / C2HC zinc-binding finger
10	PF05605 zf-Di19	89	14.8	Drought induced 19 protein (Di19), zinc-binding
11	PF13465 zf-H2C2_2	1.7e-42	153.2	Zinc-finger double domain
12	PF13909 zf-H2C2_5	0.009	27.0	C2H2-type zinc-finger domain
13	PF08790 zf-LYAR	0.052	24.7	LYAR-type C2HC zinc finger
14	PF02591 zf-RING_7	57	15.3	C4-type zinc ribbon domain
15	PF13451 zf-trcl	76	14.6	Probable zinc-ribbon domain
16	PF18439 zf_UBZ	0.041	24.8	Ubiquitin-Binding Zinc Finger
17	PF17032 zinc_ribbon_15	0.73	22.0	zinc-ribbon family
18	PF14369 zinc_ribbon_9	4.6e+02	12.5	zinc-ribbon
19	PF09723 Zn-ribbon_8	0.76	21.3	Zinc ribbon domain
20	PF17283 Zn_ribbon_SprT	11	17.4	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348510	0.712	General transcription factor 3C polypeptide 1
2	9606.ENSP00000352536	0.614	General transcription factor 3C polypeptide 2
3	9606.ENSP00000246801	0.501	Testis-specific serine kinase substrate

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0031323	0.906	regulation of cellular metabolic process
GO:0051171	0.899	regulation of nitrogen compound metabolic process
GO:0009987	0.896	cellular process
GO:0009889	0.896	regulation of biosynthetic process
GO:0080090	0.895	regulation of primary metabolic process
GO:0060255	0.892	regulation of macromolecule metabolic process
GO:0031326	0.884	regulation of cellular biosynthetic process
GO:0019219	0.875	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.873	regulation of macromolecule biosynthetic process
GO:0006355	0.777	regulation of DNA-templated transcription
GO:0031324	0.570	negative regulation of cellular metabolic process
GO:0051172	0.563	negative regulation of nitrogen compound metabolic process
GO:0010605	0.541	negative regulation of macromolecule metabolic process
GO:0008152	0.378	metabolic process
GO:1903507	0.356	negative regulation of nucleic acid-templated transcription
GO:0045892	0.343	negative regulation of DNA-templated transcription
GO:0071704	0.316	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.601	intracellular non-membrane-bounded organelle
GO:0032991	0.413	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]