StarFunc result for job id Q96H96

User Input

>input (371 residues)
MLGSRAAGFARGLRALALAWLPGWRGRSFALARAAGAPHGGDLQPPACPEPRGRQLSLSA
AAVVDSAPRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEPGCFPDWYMLSLFGTGAI
LMRGAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYY
SIALGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCDPSVCLPLYFSG
VMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAMLGALSLVGVNSGQT
APYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFISNRTLGLIVFLGIVLGNLWKEKKTDK
TKKGIENKIEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96H96	1.000	1.000	6.076E-49	371	1.000	1.000	Q96H96.pdb.gz	COQ2_HUMAN 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ2 PE=1 SV=2
2	AFDB:Q66JT7	0.852	0.845	1.708E-39	374	0.765	0.759	Q66JT7.pdb.gz	COQ2_MOUSE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Coq2 PE=1 SV=2
3	AFDB:Q9VHS7	0.779	0.738	1.600E-31	392	0.544	0.515	Q9VHS7.pdb.gz	COQ2_DROME 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Coq2 PE=2 SV=1
4	AFDB:Q8I7J4	0.797	0.831	4.840E-29	356	0.469	0.489	Q8I7J4.pdb.gz	COQ2_CAEEL 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-2 PE=3 SV=2
5	AFDB:F4JPA9	0.741	0.645	1.581E-27	429	0.480	0.415	F4JPA9.pdb.gz	F4JPA9_ARATH 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1
6	AFDB:Q10252	0.753	0.776	2.461E-24	360	0.375	0.386	Q10252.pdb.gz	COQ2_SCHPO 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppt1 PE=1 SV=2
7	AFDB:Q8W405	0.761	0.917	8.319E-24	307	0.394	0.476	Q8W405.pdb.gz	PGT1_LITER 4-hydroxybenzoate geranyltransferase 1 OS=Lithospermum erythrorhizon OX=34254 GN=PGT-1 PE=1 SV=1
8	AFDB:P32378	0.751	0.749	8.037E-23	372	0.350	0.349	P32378.pdb.gz	COQ2_YEAST 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ2 PE=1 SV=1
9	AFDB:P0AGK1	0.745	0.948	3.860E-20	290	0.261	0.334	P0AGK1.pdb.gz	UBIA_ECOLI 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=ubiA PE=1 SV=1
10	AFDB:Q383Z3	0.746	0.568	5.401E-20	490	0.307	0.233	Q383Z3.pdb.gz	Q383Z3_TRYB2 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1130 PE=3 SV=1
11	PDB:2azjA	0.420	0.529	3.405E-2	276	0.089	0.120	2azjA.pdb.gz
12	PDB:1rqiA	0.414	0.489	5.878E-2	300	0.094	0.117	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
13	PDB:3lomA	0.398	0.486	6.667E-2	288	0.092	0.118	3lomA.pdb.gz
14	PDB:3aqbD	0.357	0.400	6.953E-2	325	0.113	0.129	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
15	PDB:2ftzA	0.429	0.565	1.058E-1	265	0.081	0.113	2ftzA.pdb.gz
16	PDB:2dh4A	0.395	0.440	1.151E-1	326	0.105	0.120	2dh4A.pdb.gz	Crystal Structure of Type-III Geranylgeranyl Pyrophosphate Synthase from Saccharomyces cerevisiae and the Mechanism of Product Chain Length Determination.
17	PDB:3ipiA	0.429	0.556	1.151E-1	268	0.084	0.116	3ipiA.pdb.gz
18	PDB:6rx4B	0.256	0.252	2.351E-1	379	0.113	0.111	6rx4B.pdb.gz	Homologous bd oxidases share the same architecture but differ in mechanism.
19	PDB:6jb1B	0.109	0.052	3.154E-1	1366	0.116	0.031	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
20	PDB:4okmA	0.316	0.333	3.731E-1	346	0.102	0.110	4okmA.pdb.gz	Induced-fit mechanism in class i terpene cyclases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q66JT7	0.0	577	374	0.792	0.786	COQ2_MOUSE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Coq2 PE=1 SV=2
2	Q96H96	0.0	752	371	0.997	0.997	COQ2_HUMAN 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ2 PE=1 SV=2
3	Q9VHS7	5.01e-136	395	392	0.509	0.482	COQ2_DROME 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Coq2 PE=2 SV=1
4	Q8I7J4	1.29e-112	334	356	0.458	0.478	COQ2_CAEEL 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-2 PE=3 SV=2
5	F4JPA9	4.93e-100	305	429	0.474	0.410	F4JPA9_ARATH 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1
6	Q8W405	3.57e-93	283	307	0.391	0.472	PGT1_LITER 4-hydroxybenzoate geranyltransferase 1 OS=Lithospermum erythrorhizon OX=34254 GN=PGT-1 PE=1 SV=1
7	Q10252	4.60e-83	259	360	0.375	0.386	COQ2_SCHPO 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppt1 PE=1 SV=2
8	P32378	3.20e-73	234	372	0.348	0.347	COQ2_YEAST 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ2 PE=1 SV=1
9	Q383Z3	1.51e-48	172	490	0.310	0.235	Q383Z3_TRYB2 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1130 PE=3 SV=1
10	P0AGK1	2.58e-48	167	290	0.261	0.334	UBIA_ECOLI 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=ubiA PE=1 SV=1
11	C6KSS3	2.23e-33	132	521	0.245	0.175	C6KSS3_PLAF7 4-hydroxybenzoate polyprenyltransferase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0607500 PE=3 SV=1
12	W6QIT8	8.98e-21	94.0	325	0.208	0.237	MPAA_PENRF Polyprenyl transferase mpaA OS=Penicillium roqueforti (strain FM164) OX=1365484 GN=mpaA PE=3 SV=1
13	A0A0B5L778	7.11e-20	91.7	331	0.183	0.205	MPAA2_PENBR Polyprenyl transferase mpaA' OS=Penicillium brevicompactum OX=5074 GN=mpaA' PE=1 SV=1
14	A0A2I1BT09	8.26e-19	88.2	316	0.226	0.266	NVFB_ASPN1 DMOA farnesyltransferase nvfB OS=Aspergillus novofumigatus (strain IBT 16806) OX=1392255 GN=nvfB PE=1 SV=1
15	Q5AR21	3.27e-15	77.8	330	0.124	0.139	AUSN_EMENI Polyprenyl transferase ausN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ausN PE=3 SV=1
16	Q12887	2.53e-06	51.6	443	0.121	0.102	COX10_HUMAN Protoheme IX farnesyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COX10 PE=1 SV=3
17	Q8CFY5	5.19e-06	50.4	443	0.140	0.117	COX10_MOUSE Protoheme IX farnesyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Cox10 PE=2 SV=1
18	P21592	6.83e-06	50.1	462	0.137	0.110	COX10_YEAST Protoheme IX farnesyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX10 PE=3 SV=1
19	P0AEA5	0.004	41.2	296	0.105	0.132	CYOE_ECOLI Protoheme IX farnesyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=cyoE PE=1 SV=1
20	P9WFR7	0.037	38.1	308	0.129	0.156	COXX_MYCTU Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ctaB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01040 UbiA	9.7e-48	174.2	UbiA prenyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310873

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333946	0.996	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
2	9606.ENSP00000358033	0.995	Decaprenyl-diphosphate synthase subunit 2
3	9606.ENSP00000365388	0.995	Decaprenyl-diphosphate synthase subunit 1
4	9606.ENSP00000254759	0.963	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
5	9606.ENSP00000262507	0.947	Ubiquinone biosynthesis protein COQ9, mitochondrial
6	9606.ENSP00000300452	0.946	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
7	9606.ENSP00000288532	0.945	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
8	9606.ENSP00000355741	0.941	Atypical kinase COQ8A, mitochondrial
9	9606.ENSP00000315118	0.940	Atypical kinase COQ8B, mitochondrial
10	9606.ENSP00000322316	0.933	5-demethoxyubiquinone hydroxylase, mitochondrial
11	9606.ENSP00000249269	0.905	Mitochondrial-processing peptidase subunit beta
12	9606.ENSP00000360782	0.905	Mitochondrial-processing peptidase subunit alpha
13	9606.ENSP00000441823	0.905	Sal-like protein 3
14	9606.ENSP00000370377	0.902	Presequence protease, mitochondrial
15	9606.ENSP00000366006	0.812	UbiA prenyltransferase domain-containing protein 1
16	9606.ENSP00000400806	0.787	Aprataxin
17	9606.ENSP00000426638	0.781	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
18	9606.ENSP00000312587	0.766	Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
19	9606.ENSP00000262030	0.721	ATP synthase subunit beta, mitochondrial
20	9606.ENSP00000328570	0.719	Glutaredoxin-related protein 5, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002094	1.000	polyprenyltransferase activity
GO:0005488	0.478	binding
GO:0005515	0.381	protein binding
GO:0002083	0.353	4-hydroxybenzoate decaprenyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.997	metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.949	primary metabolic process
GO:0042181	0.942	ketone biosynthetic process
GO:0006744	0.918	ubiquinone biosynthetic process
GO:1901615	0.845	organic hydroxy compound metabolic process
GO:0019751	0.795	polyol metabolic process
GO:0019400	0.770	alditol metabolic process
GO:0006071	0.595	glycerol metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.987	membrane
GO:0031090	0.884	organelle membrane
GO:0031966	0.866	mitochondrial membrane
GO:0019866	0.856	organelle inner membrane
GO:0005743	0.853	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.5.1.-	1.000	Transferring alkyl or aryl groups, other than methyl groups.
RHEA:44564	0.353	4-hydroxybenzoate + all-trans-decaprenyl diphosphate = 4-hydroxy-3-all-trans-decaprenylbenzoate + diphosphate
EC:2.5.1.39	0.353	4-hydroxybenzoate polyprenyltransferase.

[back to server]