StarFunc result for job id Q96HA1

User Input

>input (1249 residues)
MSPAAAAAGAGERRRPIASVRDGRGRGCGGPARAVLLGLSLVGLLLYLVPAAAALAWLTV
GATAAWWGLSREPRGSRPLSSFVRKARHRRPLSSFVRKARHRRTLFASPLAKSTANGNLL
EPRTLLEGPDPAELLLMGSYLGKPGPPQPAAAPEGQDLRDRPGRRPPARPAPRSPPPRSP
PPRSPPPSPPTHRAHHVYPSLPTPLLRPSRRPSPRDCGTLPNRFVITPRRRYPIHQAQYS
CLGVLPTVCWNGYHKKAVLSPRNSRMVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPS
SNAPDPCAKETVLSALKEKEKKRTVEEEDQIFLDGQENKRRRHDSSGSGHSAFEPLVANG
VPASFVPKPGSLKRGLNSQSSDDHLNKRSRSSSMSSLTGAYASGIPSSSRNAITSSYSST
RGISQLWKRNGPSSSPFSSPASSRSQTPERPAKKIREEELCHHSSSSTPLAADRESQGEK
AADTTPRKKQNSNSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEK
KASLQWFNQALEDKSDAASNSVTETPPITQPSFTFTLPAAAPASPPTSLLAPSTNPLLES
LKKMQTPPSLPPCPESAGAATTEALSPPKTPSLLPPLGLSQSGPPGLLPSPSFDSKPPTT
LLGLIPAPSMVPATDTKAPPTLQAETATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPA
ASSAPPMFKPIFTAPPKSEKEGPTPPGPSVTATAPSSSSLPTTTSTTAPTFQPVFSSMGP
PASVPLPAPFFKQTTTPATAPTTTAPLFTGLASATSAVAPITSASPSTDSASKPAFGFGI
NSVSSSSVSTTTSTATAASQPFLFGAPQASAASFTPAMGSIFQFGKPPALPTTTTVTTFS
QSLHTAVPTATSSSAADFSGFGSTLATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPL
PSYPGANPQPAFGAAEGQPPGAAKPALAPSFGSSFTFGNSAAPAAAPTPAPPSMIKVVPA
YVPTPIHPIFGGATHSAFGLKATASAFGAPASSQPAFGGSTAVFFGAATSSGFGATTQTA
SSGSSSSVFGSTTPSPFTFGGSAAPAGSGSFGINVATPGSSTTTGAFSFGAGQSGSTATS
TPFAGGLGQNALGTTGQSTPFAFNVSSTTESKPVFGGTATPTFGLNTPAPGVGTSGSSLS
FGASSAPAQGFVGVAPFGSAALSFSIGAGSKTPGARQRLQARRQHTRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52591	0.144	0.147	0.000	1199	0.678	0.706	P52591.pdb.gz	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
2	AFDB:Q96HA1	0.999	0.999	0.000	1249	1.000	1.000	Q96HA1.pdb.gz	P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2
3	AFDB:Q09904	0.030	0.032	5.934E-7	1159	0.177	0.191	Q09904.pdb.gz	NU124_SCHPO Nucleoporin nup124 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup124 PE=1 SV=1
4	AFDB:Q9NZP6	0.034	0.036	5.934E-7	1156	0.218	0.235	Q9NZP6.pdb.gz	NPAP1_HUMAN Nuclear pore-associated protein 1 OS=Homo sapiens OX=9606 GN=NPAP1 PE=1 SV=2
5	AFDB:Q9Z1Q1	0.032	0.023	1.488E-6	1818	0.170	0.117	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
6	AFDB:Q9CAF4	0.040	0.039	4.692E-6	1309	0.201	0.192	Q9CAF4.pdb.gz	NUP1_ARATH Nuclear pore complex protein NUP1 OS=Arabidopsis thaliana OX=3702 GN=NUP1 PE=1 SV=1
7	AFDB:E9Q4F7	0.038	0.021	1.089E-5	2643	0.175	0.082	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
8	AFDB:P91457	0.031	0.034	1.089E-5	1217	0.191	0.196	P91457.pdb.gz	P91457_CAEEL RanBP2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-7 PE=1 SV=1
9	AFDB:P49790	0.039	0.035	1.725E-5	1475	0.198	0.167	P49790.pdb.gz	NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2
10	AFDB:P21519	0.039	0.033	2.010E-5	1594	0.162	0.127	P21519.pdb.gz	MAM_DROME Neurogenic protein mastermind OS=Drosophila melanogaster OX=7227 GN=mam PE=2 SV=2
11	PDB:3zqqC	0.021	0.117	8.109	134	0.004	0.037	3zqqC.pdb.gz
12	PDB:7odrl	0.026	0.292	9.451	82	0.008	0.122	7odrl.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8CG34	0.0	1834	1229	0.948	0.963	P121C_HUMAN Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C PE=1 SV=3
2	P52591	0.0	1075	1199	0.622	0.648	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
3	Q96HA1	0.0	2407	1249	1.000	1.000	P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2
4	C9J370	1.21e-41	155	250	0.059	0.296	C9J370_HUMAN POM121 and ZP3 fusion (Fragment) OS=Homo sapiens OX=9606 GN=POMZP3 PE=4 SV=1
5	Q6PJE2	5.42e-36	137	187	0.058	0.390	POZP3_HUMAN POM121 and ZP3 fusion protein OS=Homo sapiens OX=9606 GN=POMZP3 PE=2 SV=4
6	Q3SYA9	6.91e-26	114	428	0.110	0.322	P12L1_HUMAN Putative POM121-like protein 1 OS=Homo sapiens OX=9606 GN=POM121L1P PE=5 SV=2
7	Q9NZP6	6.10e-12	72.8	1156	0.058	0.063	NPAP1_HUMAN Nuclear pore-associated protein 1 OS=Homo sapiens OX=9606 GN=NPAP1 PE=1 SV=2
8	M9PCJ6	1.90e-05	52.0	18641	0.087	0.006	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PC48	1.91e-05	52.0	18095	0.087	0.006	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	Q8RY25	1.89e-04	48.5	1041	0.090	0.108	NU98A_ARATH Nuclear pore complex protein NUP98A OS=Arabidopsis thaliana OX=3702 GN=NUP98A PE=1 SV=1
11	G5EEH9	0.011	42.7	1678	0.038	0.029	NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans OX=6239 GN=npp-10 PE=1 SV=1
12	F4ID16	0.023	41.6	997	0.064	0.080	NU98B_ARATH Nuclear pore complex protein NUP98B OS=Arabidopsis thaliana OX=3702 GN=NUP98B PE=1 SV=1
13	Q6DIC6	0.17	38.9	2087	0.056	0.034	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
14	Q12816	0.34	37.7	1431	0.099	0.087	TROP_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=3
15	D4ACK1	0.69	37.0	2068	0.049	0.029	D4ACK1_RAT Nucleoporin 214 OS=Rattus norvegicus OX=10116 GN=Nup214 PE=1 SV=3
16	Q99PB3	0.74	36.6	1987	0.058	0.036	Q99PB3_MOUSE Mage-d3 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
17	Q80TJ5	1.4	35.8	1736	0.059	0.043	Q80TJ5_MOUSE MKIAA1114 protein (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
18	A0A0R4IAQ8	2.7	35.0	1807	0.035	0.024	A0A0R4IAQ8_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=2
19	E7F981	2.7	34.7	1814	0.035	0.024	E7F981_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=3
20	P52948	3.2	34.7	1817	0.047	0.032	NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15229 POM121	2.4e-98	340.1	POM121 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378687

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481575	0.916	Nuclear envelope pore membrane protein POM 121C
2	9606.ENSP00000446215	0.913	GTP-binding nuclear protein Ran
3	9606.ENSP00000484669	0.905	Cleavage and polyadenylation specificity factor subunit 1
4	9606.ENSP00000220592	0.904	Protein argonaute-2
5	9606.ENSP00000378295	0.904	Inner centromere protein
6	9606.ENSP00000256442	0.902	G2/mitotic-specific cyclin-B1
7	9606.ENSP00000285873	0.902	Gem-associated protein 5
8	9606.ENSP00000288207	0.902	G2/mitotic-specific cyclin-B2
9	9606.ENSP00000302961	0.902	Heat shock protein family A member 4
10	9606.ENSP00000313950	0.902	Aurora kinase B
11	9606.ENSP00000321706	0.902	Gem-associated protein 4
12	9606.ENSP00000324173	0.902	78 kDa glucose-regulated protein
13	9606.ENSP00000367623	0.902	Heat shock 70 kDa protein 14
14	9606.ENSP00000405965	0.902	Small ubiquitin-related modifier 2
15	9606.ENSP00000409666	0.902	Small ubiquitin-like modifier 3
16	9606.ENSP00000454852	0.902	Snurportin-1
17	9606.ENSP00000245934	0.901	Symplekin
18	9606.ENSP00000256079	0.901	Importin-8
19	9606.ENSP00000292476	0.901	Cleavage and polyadenylation specificity factor subunit 4
20	9606.ENSP00000308622	0.901	Nucleoporin GLE1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0016043	0.976	cellular component organization
GO:0006996	0.972	organelle organization
GO:0043933	0.943	protein-containing complex organization
GO:0006997	0.918	nucleus organization
GO:0006999	0.817	nuclear pore organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005635	0.999	nuclear envelope
GO:0005654	0.999	nucleoplasm
GO:0031090	0.996	organelle membrane
GO:0031965	0.983	nuclear membrane
GO:0032991	0.911	protein-containing complex
GO:0140513	0.610	nuclear protein-containing complex
GO:0005829	0.501	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]