StarFunc result for job id Q96HE7

User Input

>input (468 residues)
MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYR
LFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKY
SEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVD
LLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGL
CVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRR
LKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDE
NSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKL
IANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96HE7	1.000	1.000	1.556E-69	468	1.000	1.000	Q96HE7.pdb.gz	ERO1A_HUMAN ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2
2	AFDB:Q86YB8	0.751	0.753	8.714E-40	467	0.598	0.600	Q86YB8.pdb.gz	ERO1B_HUMAN ERO1-like protein beta OS=Homo sapiens OX=9606 GN=ERO1B PE=1 SV=2
3	AFDB:Q9V3A6	0.805	0.781	2.944E-33	483	0.447	0.433	Q9V3A6.pdb.gz	ERO1L_DROME Ero1-like protein OS=Drosophila melanogaster OX=7227 GN=Ero1L PE=2 SV=2
4	AFDB:Q7YTU4	0.639	0.627	1.019E-25	478	0.397	0.389	Q7YTU4.pdb.gz	ERO1_CAEEL Endoplasmic reticulum oxidoreductin-1 OS=Caenorhabditis elegans OX=6239 GN=ero-1 PE=3 SV=2
5	AFDB:Q9Y7P1	0.744	0.622	3.993E-24	567	0.316	0.261	Q9Y7P1.pdb.gz	ERO12_SCHPO ERO1-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ero12 PE=1 SV=2
6	AFDB:F4IU09	0.663	0.648	1.047E-22	479	0.338	0.330	F4IU09.pdb.gz	F4IU09_ARATH Endoplasmic reticulum oxidoreductins 2 OS=Arabidopsis thaliana OX=3702 GN=ERO2 PE=1 SV=1
7	AFDB:Q9C7S7	0.657	0.655	1.958E-22	469	0.340	0.339	Q9C7S7.pdb.gz	ERO1_ARATH Endoplasmic reticulum oxidoreductin-1 OS=Arabidopsis thaliana OX=3702 GN=AERO1 PE=1 SV=1
8	AFDB:Q6AVU2	0.651	0.643	1.533E-21	474	0.363	0.359	Q6AVU2.pdb.gz	Q6AVU2_ORYSJ Endoplasmic oxidoreductin 1, putative, expressed OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os03g52340 PE=1 SV=1
9	AFDB:O74401	0.649	0.650	4.805E-20	467	0.293	0.293	O74401.pdb.gz	ERO11_SCHPO ERO1-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ero11 PE=1 SV=1
10	AFDB:Q03103	0.589	0.496	1.652E-16	563	0.276	0.229	Q03103.pdb.gz	ERO1_YEAST Endoplasmic oxidoreductin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERO1 PE=1 SV=1
11	PDB:6ibbA	0.110	0.146	1.642E-1	301	0.073	0.113	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
12	PDB:7ru6A	0.071	0.092	1.028	315	0.058	0.086	7ru6A.pdb.gz	Antiviral HIV-1 SERINC restriction factors disrupt virus membrane asymmetry.
13	PDB:7td3R	0.097	0.134	1.028	292	0.073	0.116	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
14	PDB:7ph3A	0.077	0.065	1.230	577	0.075	0.061	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
15	PDB:7dl9A	0.103	0.113	1.538	405	0.075	0.086	7dl9A.pdb.gz
16	PDB:1z7cA	0.070	0.145	1.609	161	0.053	0.155	1z7cA.pdb.gz
17	PDB:7f61A	0.115	0.156	1.609	301	0.058	0.090	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
18	PDB:6zfzA	0.090	0.093	1.924	446	0.071	0.074	6zfzA.pdb.gz	From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease.
19	PDB:3v2yA	0.105	0.107	2.200	455	0.060	0.062	3v2yA.pdb.gz	Crystal structure of a lipid G protein-coupled receptor.
20	PDB:5tzyA	0.087	0.094	2.200	418	0.066	0.074	5tzyA.pdb.gz	Structural basis for the cooperative allosteric activation of the free fatty acid receptor GPR40.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YB8	0.0	603	467	0.598	0.600	ERO1B_HUMAN ERO1-like protein beta OS=Homo sapiens OX=9606 GN=ERO1B PE=1 SV=2
2	Q8R180	0.0	867	464	0.889	0.897	ERO1A_MOUSE ERO1-like protein alpha OS=Mus musculus OX=10090 GN=Ero1a PE=1 SV=2
3	Q8R2E9	0.0	609	467	0.603	0.604	ERO1B_MOUSE ERO1-like protein beta OS=Mus musculus OX=10090 GN=Ero1b PE=1 SV=1
4	Q8R4A1	0.0	862	464	0.882	0.890	ERO1A_RAT ERO1-like protein alpha OS=Rattus norvegicus OX=10116 GN=Ero1a PE=1 SV=1
5	Q96HE7	0.0	970	468	1.000	1.000	ERO1A_HUMAN ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2
6	Q9V3A6	1.02e-139	411	483	0.479	0.464	ERO1L_DROME Ero1-like protein OS=Drosophila melanogaster OX=7227 GN=Ero1L PE=2 SV=2
7	Q7YTU4	7.45e-114	345	478	0.406	0.397	ERO1_CAEEL Endoplasmic reticulum oxidoreductin-1 OS=Caenorhabditis elegans OX=6239 GN=ero-1 PE=3 SV=2
8	Q9C7S7	3.89e-87	276	469	0.355	0.354	ERO1_ARATH Endoplasmic reticulum oxidoreductin-1 OS=Arabidopsis thaliana OX=3702 GN=AERO1 PE=1 SV=1
9	Q6AVU2	1.39e-82	265	474	0.353	0.348	Q6AVU2_ORYSJ Endoplasmic oxidoreductin 1, putative, expressed OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os03g52340 PE=1 SV=1
10	F4IU09	2.80e-82	264	479	0.342	0.334	F4IU09_ARATH Endoplasmic reticulum oxidoreductins 2 OS=Arabidopsis thaliana OX=3702 GN=ERO2 PE=1 SV=1
11	Q9Y7P1	2.54e-64	219	567	0.323	0.266	ERO12_SCHPO ERO1-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ero12 PE=1 SV=2
12	A0A1D8PER8	6.33e-56	197	580	0.312	0.252	A0A1D8PER8_CANAL ER oxidoreductin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ERO1 PE=3 SV=1
13	Q03103	2.51e-55	195	563	0.295	0.245	ERO1_YEAST Endoplasmic oxidoreductin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERO1 PE=1 SV=1
14	O74401	7.52e-52	184	467	0.297	0.298	ERO11_SCHPO ERO1-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ero11 PE=1 SV=1
15	Q57UW3	2.75e-32	130	442	0.252	0.267	Q57UW3_TRYB2 Endoplasmic reticulum oxidoreductin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.590 PE=3 SV=1
16	F4I4P3	2.4	33.5	1615	0.034	0.010	MED23_ARATH Mediator of RNA polymerase II transcription subunit 23 OS=Arabidopsis thaliana OX=3702 GN=MED23 PE=1 SV=1
17	Q9M9L7	3.8	32.7	942	0.066	0.033	LONM4_ARATH Lon protease homolog 4, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LON4 PE=3 SV=1
18	F4JZ24	6.4	31.6	289	0.021	0.035	P4H10_ARATH Probable prolyl 4-hydroxylase 10 OS=Arabidopsis thaliana OX=3702 GN=P4H10 PE=3 SV=1
19	Q04089	6.5	31.6	582	0.028	0.022	DOT1_YEAST Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOT1 PE=1 SV=1
20	Q9USY3	6.8	31.6	708	0.077	0.051	NAA35_SCHPO N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mak10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04137 ERO1	2.1e-120	413.7	Endoplasmic Reticulum Oxidoreductin 1 (ERO1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379042

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327801	0.999	Protein disulfide-isomerase
2	9606.ENSP00000262455	0.985	Endoplasmic reticulum resident protein 44
3	9606.ENSP00000286091	0.977	Protein disulfide-isomerase A4
4	9606.ENSP00000354677	0.935	Glutathione peroxidase 7
5	9606.ENSP00000380432	0.935	Insulin
6	9606.ENSP00000300289	0.934	Protein disulfide-isomerase A3
7	9606.ENSP00000423822	0.905	Glutathione peroxidase 8
8	9606.ENSP00000346635	0.880	ERO1-like protein beta
9	9606.ENSP00000369081	0.875	Thioredoxin domain-containing protein 5
10	9606.ENSP00000324173	0.862	78 kDa glucose-regulated protein
11	9606.ENSP00000219406	0.861	Protein disulfide-isomerase A2
12	9606.ENSP00000385385	0.824	Protein disulfide-isomerase A6
13	9606.ENSP00000401445	0.789	Serine/threonine-protein kinase/endoribonuclease IRE1
14	9606.ENSP00000216037	0.773	X-box-binding protein 1
15	9606.ENSP00000247461	0.749	Calnexin
16	9606.ENSP00000306253	0.741	Inositol 1,4,5-trisphosphate receptor type 1
17	9606.ENSP00000368646	0.719	Peroxiredoxin-4
18	9606.ENSP00000261735	0.717	Endoplasmic reticulum resident protein 29
19	9606.ENSP00000305465	0.711	Protein disulfide-isomerase-like protein of the testis
20	9606.ENSP00000263556	0.691	Prolyl 4-hydroxylase subunit alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015036	1.000	disulfide oxidoreductase activity
GO:0140096	0.660	catalytic activity, acting on a protein
GO:0015035	0.426	protein-disulfide reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050896	0.992	response to stimulus
GO:0065007	0.913	biological regulation
GO:0008152	0.886	metabolic process
GO:0071704	0.884	organic substance metabolic process
GO:0044238	0.806	primary metabolic process
GO:0006457	0.762	protein folding
GO:0006807	0.712	nitrogen compound metabolic process
GO:0019538	0.678	protein metabolic process
GO:0051716	0.602	cellular response to stimulus
GO:0006950	0.578	response to stress
GO:0050789	0.531	regulation of biological process
GO:0043412	0.522	macromolecule modification
GO:0050794	0.507	regulation of cellular process
GO:0042221	0.440	response to chemical
GO:0033554	0.428	cellular response to stress
GO:0036211	0.411	protein modification process
GO:0019725	0.331	cellular homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.994	intracellular organelle lumen
GO:0005783	0.989	endoplasmic reticulum
GO:0005576	0.969	extracellular region
GO:0016020	0.967	membrane
GO:0005615	0.903	extracellular space
GO:0005788	0.837	endoplasmic reticulum lumen
GO:0005634	0.624	nucleus
GO:0031981	0.561	nuclear lumen
GO:0005794	0.481	Golgi apparatus
GO:0005654	0.474	nucleoplasm
GO:0070062	0.348	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	1.000	Acting on a sulfur group of donors.

[back to server]