StarFunc result for job id Q96HF1

User Input

>input (295 residues)
MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKND
DDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLK
DSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1WBV2	0.930	0.930	2.173E-56	295	0.976	0.976	B1WBV2.pdb.gz	B1WBV2_RAT Secreted frizzled-related protein 2 OS=Rattus norvegicus OX=10116 GN=Sfrp2 PE=3 SV=1
2	AFDB:Q9IA96	0.883	0.892	5.509E-49	292	0.800	0.808	Q9IA96.pdb.gz	SFRP2_CHICK Secreted frizzled-related protein 2 OS=Gallus gallus OX=9031 GN=SFRP2 PE=2 SV=1
3	AFDB:Q7ZXM6	0.528	0.525	1.891E-46	298	0.790	0.782	Q7ZXM6.pdb.gz	Q7ZXM6_XENLA Secreted frizzled-related protein 2 S homeolog precursor OS=Xenopus laevis OX=8355 GN=sfrp2.S PE=2 SV=1
4	AFDB:Q8AWG4	0.462	0.434	1.215E-31	315	0.369	0.346	Q8AWG4.pdb.gz	Q8AWG4_XENLA Secreted frizzled-related protein 5 OS=Xenopus laevis OX=8355 GN=sfrp5.L PE=2 SV=1
5	AFDB:F1QJG6	0.465	0.444	3.474E-31	310	0.417	0.397	F1QJG6.pdb.gz
6	AFDB:Q5T4F7	0.445	0.416	2.681E-30	317	0.407	0.379	Q5T4F7.pdb.gz	SFRP5_HUMAN Secreted frizzled-related protein 5 OS=Homo sapiens OX=9606 GN=SFRP5 PE=2 SV=3
7	AFDB:Q8C4U3	0.432	0.407	1.421E-28	314	0.393	0.369	Q8C4U3.pdb.gz	SFRP1_MOUSE Secreted frizzled-related protein 1 OS=Mus musculus OX=10090 GN=Sfrp1 PE=1 SV=3
8	AFDB:A0A0B5JK22	0.445	0.444	2.790E-27	296	0.386	0.385	A0A0B5JK22.pdb.gz
9	AFDB:Q9I897	0.462	0.462	2.046E-24	295	0.329	0.329	Q9I897.pdb.gz	Q9I897_XENLA Crescent OS=Xenopus laevis OX=8355 GN=frzb2.L PE=2 SV=1
10	AFDB:Q9GUF5	0.390	0.367	3.001E-23	314	0.322	0.303	Q9GUF5.pdb.gz	Q9GUF5_CAEEL Secreted frizzled-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=sfrp-1 PE=3 SV=2
11	PDB:1ueaB	0.270	0.416	8.232E-4	181	0.047	0.077	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
12	PDB:1bbuA	0.177	0.114	2.735E-2	486	0.054	0.033	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
13	PDB:7nycA	0.272	0.060	3.073E-2	1542	0.092	0.018	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	PDB:3kf6B	0.187	0.389	4.115E-2	105	0.051	0.143	3kf6B.pdb.gz
15	PDB:1gxdC	0.289	0.424	4.362E-2	192	0.054	0.083	1gxdC.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
16	PDB:1e1tA	0.145	0.094	6.565E-2	485	0.051	0.031	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
17	PDB:1u5kA	0.212	0.254	7.378E-2	242	0.017	0.021	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
18	PDB:6w6wC	0.183	0.171	7.378E-2	323	0.058	0.053	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
19	PDB:2pi2A	0.200	0.403	7.821E-2	129	0.027	0.062	2pi2A.pdb.gz
20	PDB:4j15A	0.170	0.123	9.879E-2	431	0.054	0.037	4j15A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1WBV2	0.0	597	295	0.976	0.976	B1WBV2_RAT Secreted frizzled-related protein 2 OS=Rattus norvegicus OX=10116 GN=Sfrp2 PE=3 SV=1
2	P97299	0.0	597	295	0.980	0.980	SFRP2_MOUSE Secreted frizzled-related protein 2 OS=Mus musculus OX=10090 GN=Sfrp2 PE=1 SV=2
3	Q863H1	0.0	592	294	0.980	0.983	SFRP2_CANLF Secreted frizzled-related protein 2 OS=Canis lupus familiaris OX=9615 GN=SFRP2 PE=2 SV=1
4	Q96HF1	0.0	610	295	1.000	1.000	SFRP2_HUMAN Secreted frizzled-related protein 2 OS=Homo sapiens OX=9606 GN=SFRP2 PE=1 SV=2
5	Q9IA96	5.14e-177	492	292	0.786	0.795	SFRP2_CHICK Secreted frizzled-related protein 2 OS=Gallus gallus OX=9031 GN=SFRP2 PE=2 SV=1
6	Q7ZXM6	5.91e-175	487	298	0.783	0.775	Q7ZXM6_XENLA Secreted frizzled-related protein 2 S homeolog precursor OS=Xenopus laevis OX=8355 GN=sfrp2.S PE=2 SV=1
7	Q6YNR8	5.15e-82	251	310	0.427	0.406	Q6YNR8_DANRE Secreted frizzled-related protein 1 OS=Danio rerio OX=7955 GN=frp1 PE=2 SV=1
8	Q9XSC1	2.02e-74	232	315	0.390	0.365	SFRP5_BOVIN Secreted frizzled-related protein 5 OS=Bos taurus OX=9913 GN=SFRP5 PE=2 SV=1
9	Q9WU66	3.15e-72	226	314	0.390	0.366	SFRP5_MOUSE Secreted frizzled-related protein 5 OS=Mus musculus OX=10090 GN=Sfrp5 PE=2 SV=1
10	Q5T4F7	3.45e-71	224	317	0.386	0.360	SFRP5_HUMAN Secreted frizzled-related protein 5 OS=Homo sapiens OX=9606 GN=SFRP5 PE=2 SV=3
11	Q8AWG4	1.16e-69	220	315	0.359	0.337	Q8AWG4_XENLA Secreted frizzled-related protein 5 OS=Xenopus laevis OX=8355 GN=sfrp5.L PE=2 SV=1
12	Q7T2K9	1.24e-66	212	296	0.393	0.392	Q7T2K9_DANRE Secreted frizzled-related protein 1 OS=Danio rerio OX=7955 GN=Srfp1a PE=2 SV=1
13	Q8C4U3	2.75e-64	206	314	0.366	0.344	SFRP1_MOUSE Secreted frizzled-related protein 1 OS=Mus musculus OX=10090 GN=Sfrp1 PE=1 SV=3
14	Q8N474	4.67e-59	193	314	0.376	0.354	SFRP1_HUMAN Secreted frizzled-related protein 1 OS=Homo sapiens OX=9606 GN=SFRP1 PE=1 SV=1
15	O19116	8.03e-59	192	308	0.373	0.357	SFRP1_BOVIN Secreted frizzled-related protein 1 OS=Bos taurus OX=9913 GN=SFRP1 PE=2 SV=1
16	Q9I897	3.23e-54	180	295	0.349	0.349	Q9I897_XENLA Crescent OS=Xenopus laevis OX=8355 GN=frzb2.L PE=2 SV=1
17	Q80W55	1.54e-48	158	77	0.258	0.987	Q80W55_RAT Putative secreted frizzled related protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Sfrp2 PE=2 SV=1
18	Q9GUF5	6.24e-46	159	314	0.332	0.312	Q9GUF5_CAEEL Secreted frizzled-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=sfrp-1 PE=3 SV=2
19	Q7SX78	6.35e-42	147	282	0.288	0.301	Q7SX78_DANRE Sizzled OS=Danio rerio OX=7955 GN=sfrp PE=2 SV=1
20	Q9R168	2.19e-27	106	158	0.197	0.367	SFRP1_RAT Secreted frizzled-related protein 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Sfrp1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01392 Fz	1.9e-25	101.1	Fz domain
2	PF01759 NTR	8.4e-11	53.0	UNC-6/NTR/C345C module
3	PF12068 PH_RBD	4.5e+02	11.7	Rab-binding domain (RBD)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274063

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293549	0.971	Proto-oncogene Wnt-1
2	9606.ENSP00000340677	0.968	Protein Wnt-8b
3	9606.ENSP00000426653	0.968	Protein Wnt-8a
4	9606.ENSP00000294304	0.966	Low-density lipoprotein receptor-related protein 5
5	9606.ENSP00000261349	0.956	Low-density lipoprotein receptor-related protein 6
6	9606.ENSP00000284523	0.950	Protein Wnt-3a
7	9606.ENSP00000265441	0.935	Protein Wnt-2
8	9606.ENSP00000323901	0.921	Frizzled-2
9	9606.ENSP00000287934	0.919	Frizzled-1
10	9606.ENSP00000233948	0.910	Protein Wnt-6
11	9606.ENSP00000264634	0.896	Protein Wnt-5a
12	9606.ENSP00000290167	0.896	Protein Wnt-4
13	9606.ENSP00000358698	0.895	Protein Wnt-2b
14	9606.ENSP00000325526	0.876	Protein Wnt-11
15	9606.ENSP00000290015	0.874	Protein Wnt-9b
16	9606.ENSP00000380379	0.871	Protein Wnt-5b
17	9606.ENSP00000258411	0.868	Protein Wnt-10a
18	9606.ENSP00000285018	0.861	Protein Wnt-7a
19	9606.ENSP00000272164	0.860	Protein Wnt-9a
20	9606.ENSP00000341032	0.860	Protein Wnt-7b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0017147	0.953	Wnt-protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048523	0.995	negative regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048583	0.985	regulation of response to stimulus
GO:0009966	0.979	regulation of signal transduction
GO:0032502	0.976	developmental process
GO:0032501	0.976	multicellular organismal process
GO:0048856	0.974	anatomical structure development
GO:0030178	0.971	negative regulation of Wnt signaling pathway
GO:0060828	0.957	regulation of canonical Wnt signaling pathway
GO:0050896	0.955	response to stimulus
GO:0007154	0.953	cell communication
GO:0048518	0.939	positive regulation of biological process
GO:0048522	0.934	positive regulation of cellular process
GO:0019222	0.912	regulation of metabolic process
GO:0007275	0.892	multicellular organism development
GO:0060255	0.889	regulation of macromolecule metabolic process
GO:0051716	0.888	cellular response to stimulus
GO:0080090	0.878	regulation of primary metabolic process
GO:0090090	0.878	negative regulation of canonical Wnt signaling pathway
GO:0051171	0.877	regulation of nitrogen compound metabolic process
GO:0031323	0.875	regulation of cellular metabolic process
GO:0023052	0.864	signaling
GO:0007165	0.818	signal transduction
GO:0048731	0.813	system development
GO:0050793	0.791	regulation of developmental process
GO:0009967	0.752	positive regulation of signal transduction
GO:0042981	0.740	regulation of apoptotic process
GO:0009893	0.730	positive regulation of metabolic process
GO:0010604	0.719	positive regulation of macromolecule metabolic process
GO:0010468	0.705	regulation of gene expression
GO:0009653	0.645	anatomical structure morphogenesis
GO:0065009	0.631	regulation of molecular function
GO:0019219	0.611	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.588	regulation of macromolecule biosynthetic process
GO:0031326	0.578	regulation of cellular biosynthetic process
GO:0007267	0.555	cell-cell signaling
GO:0007166	0.551	cell surface receptor signaling pathway
GO:0051173	0.508	positive regulation of nitrogen compound metabolic process
GO:0031325	0.500	positive regulation of cellular metabolic process
GO:0048513	0.492	animal organ development
GO:0051252	0.471	regulation of RNA metabolic process
GO:0010605	0.469	negative regulation of macromolecule metabolic process
GO:0016055	0.469	Wnt signaling pathway
GO:0051246	0.465	regulation of protein metabolic process
GO:0006355	0.457	regulation of DNA-templated transcription
GO:0030154	0.456	cell differentiation
GO:0009888	0.444	tissue development
GO:0051254	0.426	positive regulation of RNA metabolic process
GO:0051172	0.416	negative regulation of nitrogen compound metabolic process
GO:1902531	0.406	regulation of intracellular signal transduction
GO:0010557	0.395	positive regulation of macromolecule biosynthetic process
GO:1903508	0.388	positive regulation of nucleic acid-templated transcription
GO:0045893	0.384	positive regulation of DNA-templated transcription
GO:0060548	0.338	negative regulation of cell death
GO:0051239	0.325	regulation of multicellular organismal process
GO:0042127	0.322	regulation of cell population proliferation
GO:0007399	0.317	nervous system development
GO:0042221	0.312	response to chemical
GO:0060070	0.306	canonical Wnt signaling pathway
GO:0043408	0.303	regulation of MAPK cascade
GO:0031324	0.303	negative regulation of cellular metabolic process
GO:2001233	0.303	regulation of apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.909	cell periphery
GO:0016020	0.320	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]