StarFunc result for job id Q96HP0

User Input

>input (2047 residues)
MAASERRAFAHKINRTVAAEVRKQVSRERSGSPHSSRRCSSSLGVPLTEVVEPLDFEDVL
LSRPPDAEPGPLRDLVEFPADDLELLLQPRECRTTEPGIPKDEKLDAQVRAAVEMYIEDW
VIVHRRYQYLSAAYSPVTTDTQRERQKGLPRQVFEQDASGDERSGPEDSNDSRRGSGSPE
DTPRSSGASSIFDLRNLAADSLLPSLLERAAPEDVDRRNETLRRQHRPPALLTLYPAPDE
DEAVERCSRPEPPREHFGQRILVKCLSLKFEIEIEPIFGILALYDVREKKKISENFYFDL
NSDSMKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQGDISECCEPYMV
LKEVDTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSAGQLDRDSDSEGE
RRPAWTDRRRRGPQDRASSGDDACSFSGFRPATLTVTNFFKQEAERLSDEDLFKFLADMR
RPSSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHIKPYPDPRGRPTKEILEFPAREV
YAPHTSYRNLLYVYPHSLNFSSRQGSVRNLAVRVQYMTGEDPSQALPVIFGKSSCSEFTR
EAFTPVVYHNKSPEFYEEFKLHLPACVTENHHLLFTFYHVSCQPRPGTALETPVGFTWIP
LLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAVSSVHPQ
DPYLDKFFTLVHVLEEGAFPFRLKDTVLSEGNVEQELRASLAALRLASPEPLVAFSHHVL
DKLVRLVIRPPIISGQIVNLGRGAFEAMAHVVSLVHRSLEAAQDARGHCPQLAAYVHYAF
RLPGTEPSLPDGAPPVTVQAATLARGSGRPASLYLARSKSISSSNPDLAVAPGSVDDEVS
RILASKLLHEELALQWVVSSSAVREAILQHAWFFFQLMVKSMALHLLLGQRLDTPRKLRF
PGRFLDDITALVGSVGLEVITRVHKDVELAEHLNASLAFFLSDLLSLVDRGFVFSLVRAH
YKQVATRLQSSPNPAALLTLRMEFTRILCSHEHYVTLNLPCCPLSPPASPSPSVSSTTSQ
SSTFSSQAPDPKVTSMFELSGPFRQQHFLAGLLLTELALALEPEAEGAFLLHKKAISAVH
SLLCGHDTDPRYAEATVKARVAELYLPLLSIARDTLPRLHDFAEGPGQRSRLASMLDSDT
EGEGDIAGTINPSVAMAIAGGPLAPGSRASISQGPPTASRAGCALSAESSRTLLACVLWV
LKNTEPALLQRWATDLTLPQLGRLLDLLYLCLAAFEYKGKKAFERINSLTFKKSLDMKAR
LEEAILGTIGARQEMVRRSRERSPFGNPENVRWRKSVTHWKQTSDRVDKTKDEMEHEALV
EGNLATEASLVVLDTLEIIVQTVMLSEARESVLGAVLKVVLYSLGSAQSALFLQHGLATQ
RALVSKFPELLFEEDTELCADLCLRLLRHCGSRISTIRTHASASLYLLMRQNFEIGHNFA
RVKMQVTMSLSSLVGTTQNFSEEHLRRSLKTILTYAEEDMGLRDSTFAEQVQDLMFNLHM
ILTDTVKMKEHQEDPEMLIDLMYRIARGYQGSPDLRLTWLQNMAGKHAELGNHAEAAQCM
VHAAALVAEYLALLEDHRHLPVGCVSFQNISSNVLEESAISDDILSPDEEGFCSGKHFTE
LGLVGLLEQAAGYFTMGGLYEAVNEVYKNLIPILEAHRDYKKLAAVHGKLQEAFTKIMHQ
SSGWERVFGTYFRVGFYGAHFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERFGDDVVE
IIKDSNPVDKSKLDSQKAYIQITYVEPYFDTYELKDRVTYFDRNYGLRTFLFCTPFTPDG
RAHGELPEQHKRKTLLSTDHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTRELAFAT
EQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLAEIPEDPKLFRHHNKLRLCFKDFCKK
CEDALRKNKALIGPDQKEYHRELERNYCRLREALQPLLTQRLPQLMAPTPPGLRNSLNRA
SFRKADL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C147	0.780	0.762	0.000	2100	0.533	0.520	Q8C147.pdb.gz	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
2	AFDB:Q96HP0	1.000	1.000	0.000	2047	1.000	1.000	Q96HP0.pdb.gz	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
3	AFDB:Q96N67	0.865	0.829	0.000	2140	0.679	0.650	Q96N67.pdb.gz	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
4	AFDB:Q9VPI9	0.613	0.609	0.000	2064	0.469	0.465	Q9VPI9.pdb.gz	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
5	AFDB:A2AF47	0.616	0.609	3.682E-103	2073	0.318	0.314	A2AF47.pdb.gz	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
6	AFDB:Q9BZ29	0.575	0.570	7.500E-100	2069	0.305	0.302	Q9BZ29.pdb.gz	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
7	AFDB:Q8BIK4	0.565	0.563	1.088E-99	2055	0.300	0.299	Q8BIK4.pdb.gz	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
8	AFDB:Q8BZN6	0.646	0.618	2.759E-98	2150	0.283	0.270	Q8BZN6.pdb.gz	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
9	AFDB:M9PCG3	0.717	0.643	4.310E-98	2298	0.304	0.271	M9PCG3.pdb.gz	M9PCG3_DROME Zizimin, isoform K OS=Drosophila melanogaster OX=7227 GN=Ziz PE=1 SV=1
10	AFDB:Q86I66	0.535	0.487	2.939E-83	2284	0.255	0.229	Q86I66.pdb.gz	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
11	PDB:6tgbA	0.223	0.270	1.427E-18	1450	0.092	0.130	6tgbA.pdb.gz
12	PDB:3w3zA	0.076	0.123	4.288E-5	1013	0.064	0.130	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
13	PDB:7t3pA	0.079	0.079	1.896E-4	2066	0.084	0.083	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
14	PDB:7t3rA	0.077	0.076	1.896E-4	2130	0.083	0.079	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
15	PDB:7r5jR0	0.057	0.075	2.284E-4	1399	0.062	0.091	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:7jq9A	0.096	0.088	2.553E-4	2427	0.077	0.065	7jq9A.pdb.gz
17	PDB:7t3uA	0.065	0.065	2.750E-4	2020	0.067	0.068	7t3uA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:6vaeA	0.072	0.097	3.843E-4	1198	0.068	0.116	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
19	PDB:7mopA	0.110	0.096	3.843E-4	2445	0.065	0.054	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
20	PDB:7r5jB0	0.102	0.115	3.843E-4	1748	0.064	0.074	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AF47	0.0	844	2073	0.302	0.298	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
2	K7ESB7	0.0	4182	2082	1.000	0.983	K7ESB7_HUMAN Dedicator of cytokinesis 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=2
3	M9PCG3	0.0	736	2298	0.300	0.268	M9PCG3_DROME Zizimin, isoform K OS=Drosophila melanogaster OX=7227 GN=Ziz PE=1 SV=1
4	Q5JSL3	0.0	839	2073	0.298	0.294	DOC11_HUMAN Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2
5	Q8BIK4	0.0	826	2055	0.295	0.294	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
6	Q8BZN6	0.0	728	2187	0.264	0.247	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
7	Q8C147	0.0	2117	2100	0.533	0.520	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
8	Q8NF50	0.0	2115	2099	0.533	0.520	DOCK8_HUMAN Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8 PE=1 SV=3
9	Q8R1A4	0.0	2762	2130	0.676	0.650	DOCK7_MOUSE Dedicator of cytokinesis protein 7 OS=Mus musculus OX=10090 GN=Dock7 PE=1 SV=3
10	Q96HP0	0.0	4205	2047	1.000	1.000	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
11	Q96N67	0.0	2765	2140	0.677	0.648	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
12	Q9BZ29	0.0	822	2069	0.297	0.294	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
13	Q9VPI9	0.0	1795	2064	0.480	0.476	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
14	Q96BY6	5.04e-162	553	2186	0.182	0.170	DOC10_HUMAN Dedicator of cytokinesis protein 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=3
15	A0A2R8YD85	6.75e-162	553	2199	0.182	0.169	A0A2R8YD85_HUMAN Dedicator of cytokinesis 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=1
16	Q86I66	3.09e-112	401	2284	0.117	0.105	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
17	Q54CA8	5.21e-85	313	2147	0.107	0.102	Q54CA8_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizB PE=3 SV=1
18	Q8SAB7	4.66e-51	202	1830	0.085	0.096	SPK1_ARATH Guanine nucleotide exchange factor SPIKE 1 OS=Arabidopsis thaliana OX=3702 GN=SPK1 PE=1 SV=1
19	Q8IZD9	5.27e-13	77.4	2030	0.040	0.040	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
20	Q8CIQ7	1.71e-12	75.9	2027	0.039	0.039	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	7.7e-54	193.7	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	7.4e-24	95.0	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	2.2e-35	132.0	DHR-2, Lobe C
4	PF14429 DOCK-C2	6e-42	155.1	C2 domain in Dock180 and Zizimin proteins
5	PF11878 DOCK_C-D_N	1.2e-29	114.5	Dedicator of cytokinesis C/D, N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294618

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.966	Cell division control protein 42 homolog
2	9606.ENSP00000348461	0.931	Ras-related C3 botulinum toxin substrate 1
3	9606.ENSP00000334375	0.810	Leucine rich repeats and calponin homology domain containing 3
4	9606.ENSP00000394888	0.734	Dedicator of cytokinesis protein 8
5	9606.ENSP00000264245	0.732	Rho GTPase-activating protein 31
6	9606.ENSP00000468002	0.722	KN motif and ankyrin repeat domain-containing protein 2
7	9606.ENSP00000373206	0.720	EGF domain-specific O-linked N-acetylglucosamine transferase
8	9606.ENSP00000280333	0.648	Dedicator of cytokinesis protein 1
9	9606.ENSP00000374447	0.636	Leucine-rich repeat and calponin homology domain-containing protein 1
10	9606.ENSP00000327104	0.628	Phospholipase DDHD1
11	9606.ENSP00000262415	0.604	ATP-dependent RNA helicase DHX8
12	9606.ENSP00000311135	0.602	Probable ATP-dependent RNA helicase DHX37
13	9606.ENSP00000379366	0.578	MOB kinase activator 1B
14	9606.ENSP00000372482	0.528	Small nuclear ribonucleoprotein U11/U12 subunit 25
15	9606.ENSP00000479969	0.518	Angiopoietin-like protein 8
16	9606.ENSP00000379364	0.508	MOB kinase activator 1A
17	9606.ENSP00000483814	0.507	GATOR complex protein NPRL3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0030234	0.954	enzyme regulator activity
GO:0140677	0.952	molecular function activator activity
GO:0060589	0.936	nucleoside-triphosphatase regulator activity
GO:0030695	0.933	GTPase regulator activity
GO:0005085	0.896	guanyl-nucleotide exchange factor activity
GO:0031267	0.496	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0032501	0.817	multicellular organismal process
GO:0048518	0.708	positive regulation of biological process
GO:0048522	0.689	positive regulation of cellular process
GO:0050896	0.659	response to stimulus
GO:0071840	0.638	cellular component organization or biogenesis
GO:0051716	0.590	cellular response to stimulus
GO:0016043	0.573	cellular component organization
GO:0048583	0.527	regulation of response to stimulus
GO:0010646	0.525	regulation of cell communication
GO:0023051	0.516	regulation of signaling
GO:0009966	0.492	regulation of signal transduction
GO:0032502	0.438	developmental process
GO:0048519	0.422	negative regulation of biological process
GO:0048856	0.413	anatomical structure development
GO:1902531	0.406	regulation of intracellular signal transduction
GO:0019222	0.359	regulation of metabolic process
GO:0051056	0.358	regulation of small GTPase mediated signal transduction
GO:0048523	0.350	negative regulation of cellular process
GO:0008152	0.348	metabolic process
GO:0007275	0.315	multicellular organism development
GO:0051239	0.306	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.336	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]