StarFunc result for job id Q96HR3

User Input

>input (178 residues)
MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQL
PNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEE
DGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JWW8	0.535	0.535	6.521E-24	178	0.955	0.955	A0A0G2JWW8.pdb.gz	A0A0G2JWW8_RAT Mediator of RNA polymerase II transcription subunit 30 OS=Rattus norvegicus OX=10116 GN=Med30 PE=3 SV=1
2	AFDB:D3ZG00	0.495	0.606	2.199E-15	143	0.758	0.944	D3ZG00.pdb.gz	D3ZG00_RAT Mediator of RNA polymerase II transcription subunit 30 OS=Rattus norvegicus OX=10116 GN=Med30 PE=3 SV=1
3	PDB:7enal	0.411	0.563	6.232E-14	126	0.702	0.992	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
4	AFDB:Q9W0P3	0.431	0.253	7.170E-9	318	0.354	0.198	Q9W0P3.pdb.gz	MED30_DROME Mediator of RNA polymerase II transcription subunit 30 OS=Drosophila melanogaster OX=7227 GN=MED30 PE=1 SV=1
5	AFDB:Q8IYX8	0.386	0.155	4.142E-2	460	0.096	0.037	Q8IYX8.pdb.gz	CE57L_HUMAN Centrosomal protein CEP57L1 OS=Homo sapiens OX=9606 GN=CEP57L1 PE=1 SV=1
6	AFDB:A0A2R8QH80	0.252	0.080	8.879E-2	827	0.107	0.023	A0A2R8QH80.pdb.gz
7	AFDB:F4HPA7	0.307	0.291	9.462E-2	189	0.157	0.148	F4HPA7.pdb.gz	MD10B_ARATH Mediator of RNA polymerase II transcription subunit 10b OS=Arabidopsis thaliana OX=3702 GN=MED10B PE=1 SV=1
8	AFDB:Q5DTU0	0.300	0.091	1.008E-1	825	0.129	0.028	Q5DTU0.pdb.gz	AF1L2_MOUSE Actin filament-associated protein 1-like 2 OS=Mus musculus OX=10090 GN=Afap1l2 PE=1 SV=2
9	PDB:5oqmk	0.225	0.308	1.049E-1	127	0.169	0.236	5oqmk.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
10	AFDB:O80877	0.288	0.375	1.220E-1	125	0.090	0.128	O80877.pdb.gz	EF4L1_ARATH Protein ELF4-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=EFL1 PE=2 SV=1
11	AFDB:Q4FKA6	0.348	0.107	1.220E-1	628	0.073	0.021	Q4FKA6.pdb.gz	Q4FKA6_TRYB2 Translation initiation factor eIF2B delta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.1400 PE=3 SV=1
12	AFDB:B9EJ80	0.366	0.065	1.385E-1	1147	0.118	0.018	B9EJ80.pdb.gz	PDZD8_MOUSE PDZ domain-containing protein 8 OS=Mus musculus OX=10090 GN=Pdzd8 PE=1 SV=1
13	PDB:4gwpA	0.238	0.332	2.396E-1	112	0.084	0.134	4gwpA.pdb.gz
14	PDB:3ajwA	0.354	0.459	2.900E-1	134	0.073	0.097	3ajwA.pdb.gz
15	PDB:5n9jV	0.200	0.283	3.739E-1	99	0.056	0.101	5n9jV.pdb.gz
16	PDB:5n9jZ	0.349	0.504	3.739E-1	119	0.073	0.109	5n9jZ.pdb.gz
17	PDB:7nvrk	0.220	0.272	3.739E-1	133	0.107	0.143	7nvrk.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
18	PDB:1tjlA	0.255	0.301	4.821E-1	145	0.062	0.076	1tjlA.pdb.gz	Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription
19	PDB:5bw9g	0.335	0.414	5.475E-1	141	0.129	0.163	5bw9g.pdb.gz
20	PDB:5svaU	0.206	0.226	5.475E-1	156	0.118	0.135	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96HR3	1.29e-132	370	178	1.000	1.000	MED30_HUMAN Mediator of RNA polymerase II transcription subunit 30 OS=Homo sapiens OX=9606 GN=MED30 PE=1 SV=1
2	A0A0G2JWW8	1.18e-127	357	178	0.955	0.955	A0A0G2JWW8_RAT Mediator of RNA polymerase II transcription subunit 30 OS=Rattus norvegicus OX=10116 GN=Med30 PE=3 SV=1
3	Q9CQI9	6.03e-127	355	178	0.949	0.949	MED30_MOUSE Mediator of RNA polymerase II transcription subunit 30 OS=Mus musculus OX=10090 GN=Med30 PE=1 SV=1
4	D3ZG00	3.46e-93	269	143	0.764	0.951	D3ZG00_RAT Mediator of RNA polymerase II transcription subunit 30 OS=Rattus norvegicus OX=10116 GN=Med30 PE=3 SV=1
5	Q9W0P3	8.07e-26	102	318	0.343	0.192	MED30_DROME Mediator of RNA polymerase II transcription subunit 30 OS=Drosophila melanogaster OX=7227 GN=MED30 PE=1 SV=1
6	A0A8I6AMN9	0.62	32.7	572	0.067	0.021	A0A8I6AMN9_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=1 SV=1
7	D3ZHX6	0.63	32.7	496	0.067	0.024	D3ZHX6_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=3 SV=2
8	Q6P4T3	0.67	32.7	526	0.067	0.023	Q6P4T3_MOUSE Eyes absent homolog OS=Mus musculus OX=10090 GN=Eya3 PE=1 SV=1
9	P97480	0.73	32.7	510	0.067	0.024	EYA3_MOUSE Eyes absent homolog 3 OS=Mus musculus OX=10090 GN=Eya3 PE=1 SV=2
10	A0A0G2JZ01	0.75	32.7	602	0.067	0.020	A0A0G2JZ01_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=1 SV=2
11	A0A8I6A077	0.81	32.3	561	0.067	0.021	A0A8I6A077_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=1 SV=1
12	B1APR7	0.92	32.3	416	0.067	0.029	B1APR7_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA3 PE=1 SV=1
13	Q38CG1	1.2	31.6	239	0.180	0.134	Q38CG1_TRYB2 Vesicle-associated membrane protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7410 PE=4 SV=1
14	Q9M2P9	1.9	31.2	367	0.079	0.038	Q9M2P9_ARATH Uncharacterized protein At3g57990 OS=Arabidopsis thaliana OX=3702 GN=OEP40 PE=1 SV=1
15	Q9FR53	2.5	31.2	2481	0.213	0.015	TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana OX=3702 GN=TOR PE=1 SV=1
16	Q99504	5.6	30.0	573	0.067	0.021	EYA3_HUMAN Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3 PE=1 SV=3
17	O00587	6.3	29.6	321	0.079	0.044	MFNG_HUMAN Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Homo sapiens OX=9606 GN=MFNG PE=1 SV=2
18	Q4QBN6	7.2	29.6	5635	0.067	0.002	Q4QBN6_LEIMA Putative dynein heavy chain, cytosolic OS=Leishmania major OX=5664 GN=LMJF_22_1110 PE=4 SV=1
19	Q8BYI9	9.4	29.3	1358	0.079	0.010	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
20	A2R0E0	9.6	29.3	537	0.096	0.032	INUE_ASPNC Extracellular exo-inulinase inuE OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=inuE PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04108 ATG17_like	5.5e+02	11.3	Autophagy protein ATG17-like domain
2	PF08653 DASH_Dam1	8.2e+02	11.3	DASH complex subunit Dam1
3	PF05622 HOOK	8.9	16.5	HOOK protein coiled-coil region
4	PF11221 Med21	2.1e+02	13.6	Subunit 21 of Mediator complex
5	PF11315 Med30	1.5e-61	218.6	Mediator complex subunit 30
6	PF05531 NPV_P10	1.4e+02	14.4	Nucleopolyhedrovirus P10 protein
7	PF15136 UPF0449	1.4e+02	14.3	Uncharacterised protein family UPF0449

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005897

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000991	0.997	Mediator of RNA polymerase II transcription subunit 1
2	61853.ENSNLEP00000003648	0.997	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
3	61853.ENSNLEP00000023696	0.996	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
4	61853.ENSNLEP00000000701	0.994	Mediator of RNA polymerase II transcription subunit 13
5	61853.ENSNLEP00000017049	0.992	Cyclin-dependent kinase 8
6	61853.ENSNLEP00000002236	0.990	Mediator complex subunit 6
7	61853.ENSNLEP00000015577	0.990	Mediator complex subunit 27
8	61853.ENSNLEP00000013783	0.989	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
9	61853.ENSNLEP00000002188	0.988	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
10	61853.ENSNLEP00000000301	0.987	Mediator of RNA polymerase II transcription subunit 13
11	61853.ENSNLEP00000001446	0.987	Mediator complex subunit 24
12	61853.ENSNLEP00000001451	0.987	Mediator complex subunit 12
13	61853.ENSNLEP00000004209	0.987	Mediator complex subunit 12-like
14	61853.ENSNLEP00000004752	0.987	Mediator of RNA polymerase II transcription subunit 7
15	61853.ENSNLEP00000015585	0.987	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
16	61853.ENSNLEP00000011923	0.981	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
17	61853.ENSNLEP00000016487	0.981	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
18	61853.ENSNLEP00000020163	0.981	Mediator complex subunit 28
19	61853.ENSNLEP00000006572	0.979	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
20	61853.ENSNLEP00000015556	0.979	Cyclin-dependent kinase 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0061659	0.998	ubiquitin-like protein ligase activity
GO:0004842	0.995	ubiquitin-protein transferase activity
GO:0061630	0.994	ubiquitin protein ligase activity
GO:0003712	0.859	transcription coregulator activity
GO:0003713	0.744	transcription coactivator activity
GO:0061629	0.450	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.981	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0050794	0.972	regulation of cellular process
GO:0019222	0.969	regulation of metabolic process
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0010468	0.953	regulation of gene expression
GO:0010556	0.951	regulation of macromolecule biosynthetic process
GO:0031326	0.951	regulation of cellular biosynthetic process
GO:0051252	0.951	regulation of RNA metabolic process
GO:0048518	0.945	positive regulation of biological process
GO:2000142	0.941	regulation of DNA-templated transcription initiation
GO:0006807	0.897	nitrogen compound metabolic process
GO:0009893	0.896	positive regulation of metabolic process
GO:0048522	0.882	positive regulation of cellular process
GO:0043170	0.864	macromolecule metabolic process
GO:0010604	0.834	positive regulation of macromolecule metabolic process
GO:0051173	0.790	positive regulation of nitrogen compound metabolic process
GO:0032502	0.780	developmental process
GO:0031325	0.772	positive regulation of cellular metabolic process
GO:0006357	0.751	regulation of transcription by RNA polymerase II
GO:0098727	0.730	maintenance of cell number
GO:0009987	0.725	cellular process
GO:0051254	0.687	positive regulation of RNA metabolic process
GO:0045893	0.668	positive regulation of DNA-templated transcription
GO:0045944	0.664	positive regulation of transcription by RNA polymerase II
GO:1901564	0.610	organonitrogen compound metabolic process
GO:0019538	0.593	protein metabolic process
GO:0043412	0.592	macromolecule modification
GO:0032501	0.581	multicellular organismal process
GO:0016567	0.528	protein ubiquitination
GO:0019827	0.493	stem cell population maintenance
GO:2000144	0.487	positive regulation of DNA-templated transcription initiation
GO:0060260	0.473	regulation of transcription initiation by RNA polymerase II
GO:0060261	0.456	positive regulation of transcription initiation by RNA polymerase II
GO:0044237	0.398	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0140513	0.950	nuclear protein-containing complex
GO:0005667	0.926	transcription regulator complex
GO:0090575	0.919	RNA polymerase II transcription regulator complex
GO:0070847	0.874	core mediator complex
GO:0016592	0.786	mediator complex
GO:1990234	0.753	transferase complex
GO:0140535	0.722	intracellular protein-containing complex
GO:0000151	0.366	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]