StarFunc result for job id Q96HR8

User Input

>input (494 residues)
MEVVEAAAAQLETLKFNGTDFGVGEGPAAPSPGSAPVPGTQPPLQSFEGSPDAGQTVEVK
PAGEQPLQPVLNAVAAGTPAPQPQPPAESPACGDCVTSPGAAEPARAPDSLETSDSDSDS
DSETDSDSSSSSSSSSSSSSSSSSSCISLPPVLSDGDDDLQIEKENKNFPLKTKDELLLN
ELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKI
FEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDAS
WKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFTEVHQNWNAHSS
ASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEHMVSQETSGFPSQRQNNPIMP
QYPFPLPVFDMHNFPLRPPPPPPPPPVNMGWATPNMAAHPLLNLPYSLPPPPPPPPLPPP
PSSGDSNSHFGPYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96HR8	0.999	0.999	3.017E-66	494	1.000	1.000	Q96HR8.pdb.gz	NAF1_HUMAN H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1 PE=1 SV=2
2	AFDB:Q3UMQ8	0.389	0.393	2.559E-50	489	0.743	0.751	Q3UMQ8.pdb.gz	NAF1_MOUSE H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Mus musculus OX=10090 GN=Naf1 PE=1 SV=2
3	AFDB:O14360	0.310	0.298	4.018E-16	516	0.223	0.213	O14360.pdb.gz	NAF1_SCHPO H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naf1 PE=1 SV=1
4	AFDB:Q9LR70	0.265	0.170	7.082E-16	801	0.249	0.154	Q9LR70.pdb.gz	Q9LR70_ARATH H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Arabidopsis thaliana OX=3702 GN=NAF1 PE=1 SV=1
5	AFDB:P53919	0.295	0.295	1.938E-13	492	0.221	0.222	P53919.pdb.gz	NAF1_YEAST H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAF1 PE=1 SV=1
6	PDB:7v9aD	0.150	0.565	1.838E-3	117	0.030	0.128	7v9aD.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
7	AFDB:Q9NVR5	0.092	0.061	2.030E-3	837	0.144	0.085	Q9NVR5.pdb.gz	KTU_HUMAN Protein kintoun OS=Homo sapiens OX=9606 GN=DNAAF2 PE=1 SV=2
8	PDB:6f5dA	0.129	0.122	2.356E-2	524	0.028	0.027	6f5dA.pdb.gz	ATP synthase fromTrypanosoma bruceihas an elaborated canonical F1-domain and conventional catalytic sites.
9	AFDB:Q9VK33	0.069	0.038	2.458E-2	1220	0.111	0.045	Q9VK33.pdb.gz	SMBT_DROME Polycomb protein Sfmbt OS=Drosophila melanogaster OX=7227 GN=Sfmbt PE=1 SV=2
10	PDB:7valF	0.122	0.127	9.718E-2	471	0.024	0.025	7valF.pdb.gz	Structural snapshots of V/A-ATPase reveal the rotary catalytic mechanism of rotary ATPases.
11	PDB:7u4tE	0.123	0.129	1.088E-1	468	0.030	0.032	7u4tE.pdb.gz	Identification of mEAK-7 as a human V-ATPase regulator via cryo-EM data mining.
12	PDB:3crzA	0.134	0.231	1.152E-1	257	0.020	0.039	3crzA.pdb.gz	X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa
13	PDB:3wqyA	0.116	0.069	1.152E-1	905	0.030	0.017	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
14	PDB:2wpdE	0.124	0.129	1.290E-1	473	0.020	0.021	2wpdE.pdb.gz	Crystal Structure of the Mg.Adp-Inhibited State of the Yeast F1C10-ATP Synthase.
15	AFDB:G5EEG1	0.098	0.100	1.347E-1	482	0.123	0.127	G5EEG1.pdb.gz	NFYA1_CAEEL Nuclear transcription factor Y subunit nfya-1 OS=Caenorhabditis elegans OX=6239 GN=nfya-1 PE=1 SV=1
16	PDB:3vr4B	0.117	0.099	1.445E-1	593	0.024	0.020	3vr4B.pdb.gz
17	AFDB:Q9SV09	0.063	0.059	1.596E-1	540	0.160	0.146	Q9SV09.pdb.gz	C3H46_ARATH Zinc finger CCCH domain-containing protein 46 OS=Arabidopsis thaliana OX=3702 GN=At3g51950 PE=1 SV=1
18	PDB:7khrC	0.114	0.095	1.813E-1	600	0.016	0.013	7khrC.pdb.gz	Molecular basis of V-ATPase inhibition by bafilomycin A1.
19	PDB:4krcA	0.072	0.108	2.149E-1	297	0.018	0.030	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	AFDB:P39001	0.066	0.042	5.555E-1	836	0.156	0.092	P39001.pdb.gz	UME6_YEAST Transcriptional regulatory protein UME6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UME6 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UMQ8	0.0	560	489	0.731	0.738	NAF1_MOUSE H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Mus musculus OX=10090 GN=Naf1 PE=1 SV=2
2	Q96HR8	0.0	997	494	1.000	1.000	NAF1_HUMAN H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1 PE=1 SV=2
3	Q9LR70	1.68e-21	100	801	0.134	0.082	Q9LR70_ARATH H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Arabidopsis thaliana OX=3702 GN=NAF1 PE=1 SV=1
4	O14360	4.86e-14	76.6	516	0.123	0.118	NAF1_SCHPO H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naf1 PE=1 SV=1
5	P53919	7.88e-11	66.6	492	0.194	0.195	NAF1_YEAST H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAF1 PE=1 SV=1
6	Q19788	1.28e-09	62.4	390	0.107	0.136	Q19788_CAEEL H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Caenorhabditis elegans OX=6239 GN=CELE_F25H8.2 PE=1 SV=1
7	Q587F8	0.005	42.0	429	0.059	0.068	Q587F8_TRYB2 Gar1/Naf1 RNA binding region OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=10C8.380 PE=4 SV=1
8	G5EB21	0.14	37.4	880	0.069	0.039	G5EB21_EMENI C2H2-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02270 PE=4 SV=1
9	O23063	2.9	32.7	364	0.069	0.093	STKLP_ARATH Probable transcription factor At4g00390 OS=Arabidopsis thaliana OX=3702 GN=At4g00390 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04410 Gar1	2.9e-14	64.0	Gar1/Naf1 RNA binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274054

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274606	0.997	H/ACA ribonucleoprotein complex subunit 2
2	9606.ENSP00000358563	0.997	H/ACA ribonucleoprotein complex subunit 4
3	9606.ENSP00000332198	0.995	H/ACA ribonucleoprotein complex subunit 3
4	9606.ENSP00000232888	0.981	U3 small nucleolar RNA-interacting protein 2
5	9606.ENSP00000226796	0.930	H/ACA ribonucleoprotein complex subunit 1
6	9606.ENSP00000244230	0.930	U3 small nucleolar ribonucleoprotein protein MPP10
7	9606.ENSP00000385787	0.913	Ribonucleases P/MRP protein subunit POP1
8	9606.ENSP00000317691	0.906	Ribonuclease P protein subunit p25
9	9606.ENSP00000304353	0.904	Ribonuclease P protein subunit p20
10	9606.ENSP00000389182	0.904	Ribonuclease P protein subunit p30
11	9606.ENSP00000263694	0.903	U5 small nuclear ribonucleoprotein 40 kDa protein
12	9606.ENSP00000350098	0.902	Ribonuclease P/MRP protein subunit POP5
13	9606.ENSP00000264279	0.869	Nucleolar protein 58
14	9606.ENSP00000346725	0.862	Pescadillo homolog
15	9606.ENSP00000370589	0.862	Nucleolar protein 56
16	9606.ENSP00000348596	0.845	Protein SDA1 homolog
17	9606.ENSP00000223073	0.836	RNA-binding protein 28
18	9606.ENSP00000258772	0.836	Probable ATP-dependent RNA helicase DDX56
19	9606.ENSP00000396673	0.835	pre-rRNA processing protein FTSJ3
20	9606.ENSP00000298746	0.833	Probable tRNA pseudouridine synthase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0070034	1.000	telomerase RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.981	biological regulation
GO:0050794	0.971	regulation of cellular process
GO:0048522	0.962	positive regulation of cellular process
GO:0031323	0.955	regulation of cellular metabolic process
GO:0031324	0.948	negative regulation of cellular metabolic process
GO:0019219	0.938	regulation of nucleobase-containing compound metabolic process
GO:0071840	0.930	cellular component organization or biogenesis
GO:0031330	0.924	negative regulation of cellular catabolic process
GO:0033044	0.922	regulation of chromosome organization
GO:0051252	0.921	regulation of RNA metabolic process
GO:0042254	0.920	ribosome biogenesis
GO:2000278	0.919	regulation of DNA biosynthetic process
GO:0043487	0.905	regulation of RNA stability
GO:1902369	0.885	negative regulation of RNA catabolic process
GO:0043489	0.880	RNA stabilization
GO:0010604	0.867	positive regulation of macromolecule metabolic process
GO:0045935	0.826	positive regulation of nucleobase-containing compound metabolic process
GO:0032204	0.819	regulation of telomere maintenance
GO:0008152	0.818	metabolic process
GO:0031328	0.816	positive regulation of cellular biosynthetic process
GO:0016043	0.815	cellular component organization
GO:0010557	0.813	positive regulation of macromolecule biosynthetic process
GO:0051054	0.810	positive regulation of DNA metabolic process
GO:1904356	0.806	regulation of telomere maintenance via telomere lengthening
GO:0071704	0.801	organic substance metabolic process
GO:0044238	0.796	primary metabolic process
GO:0044237	0.796	cellular metabolic process
GO:0006807	0.784	nitrogen compound metabolic process
GO:0065003	0.766	protein-containing complex assembly
GO:0051972	0.764	regulation of telomerase activity
GO:2000573	0.764	positive regulation of DNA biosynthetic process
GO:0022618	0.762	ribonucleoprotein complex assembly
GO:0032210	0.747	regulation of telomere maintenance via telomerase
GO:0034641	0.746	cellular nitrogen compound metabolic process
GO:0006139	0.744	nucleobase-containing compound metabolic process
GO:2001252	0.733	positive regulation of chromosome organization
GO:0043170	0.722	macromolecule metabolic process
GO:0032206	0.706	positive regulation of telomere maintenance
GO:0090304	0.704	nucleic acid metabolic process
GO:0016070	0.548	RNA metabolic process
GO:0010467	0.498	gene expression
GO:0032879	0.384	regulation of localization
GO:0034470	0.375	ncRNA processing
GO:0051347	0.312	positive regulation of transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005732	0.997	sno(s)RNA-containing ribonucleoprotein complex
GO:0005737	0.651	cytoplasm
GO:0043232	0.620	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]