StarFunc result for job id Q96HS1

User Input

>input (289 residues)
MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDP
NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTL
TPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAP
IEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCR
ALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96HS1	1.000	1.000	3.812E-60	289	1.000	1.000	Q96HS1.pdb.gz	PGAM5_HUMAN Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2
2	AFDB:O46084	0.789	0.789	1.320E-33	289	0.422	0.422	O46084.pdb.gz	PGAM5_DROME Serine/threonine-protein phosphatase Pgam5, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pgam5 PE=1 SV=1
3	AFDB:Q9W173	0.674	0.695	3.204E-26	280	0.377	0.389	Q9W173.pdb.gz	Q9W173_DROME Phosphoglycerate mutase 5-2 OS=Drosophila melanogaster OX=7227 GN=Pgam5-2 PE=4 SV=1
4	AFDB:Q8I1V2	0.698	0.684	4.075E-26	295	0.294	0.288	Q8I1V2.pdb.gz	Q8I1V2_PLAF7 Phosphoglucomutase-2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0413500 PE=1 SV=1
5	AFDB:Q383P5	0.671	0.639	8.064E-24	304	0.322	0.306	Q383P5.pdb.gz	Q383P5_TRYB2 Phosphoglycerate mutase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2110 PE=4 SV=1
6	AFDB:Q12040	0.458	0.562	4.937E-11	230	0.149	0.187	Q12040.pdb.gz	YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR283W PE=1 SV=1
7	AFDB:P9WIC7	0.476	0.600	1.216E-10	223	0.149	0.193	P9WIC7.pdb.gz	GPGP_MYCTU Glucosyl-3-phosphoglycerate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gpgP PE=1 SV=1
8	PDB:1bifA	0.472	0.326	1.848E-10	432	0.142	0.095	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
9	AFDB:Q9LW33	0.478	0.358	2.820E-10	399	0.190	0.138	Q9LW33.pdb.gz	Q9LW33_ARATH Phosphoglycerate mutase family protein OS=Arabidopsis thaliana OX=3702 GN=MEF14 PE=1 SV=1
10	AFDB:P25114	0.466	0.299	3.377E-10	469	0.142	0.087	P25114.pdb.gz	F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus OX=10116 GN=Pfkfb4 PE=1 SV=3
11	AFDB:O94461	0.451	0.608	4.044E-10	209	0.173	0.239	O94461.pdb.gz	YFFL_SCHPO Probable phosphatase C1687.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1687.21 PE=3 SV=1
12	PDB:6s2rA	0.455	0.553	4.287E-10	234	0.152	0.188	6s2rA.pdb.gz
13	PDB:1k6mA	0.478	0.330	7.362E-10	432	0.135	0.090	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
14	PDB:3e9cA	0.415	0.574	8.302E-10	204	0.135	0.191	3e9cA.pdb.gz
15	PDB:2yn2A	0.440	0.494	3.307E-9	254	0.131	0.150	2yn2A.pdb.gz
16	PDB:5htkA	0.457	0.324	3.307E-9	425	0.138	0.094	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
17	PDB:3e9dA	0.427	0.489	4.205E-9	250	0.142	0.164	3e9dA.pdb.gz
18	PDB:2axnA	0.461	0.307	8.648E-9	451	0.128	0.082	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
19	PDB:4embA	0.430	0.500	9.752E-9	245	0.152	0.180	4embA.pdb.gz
20	PDB:1yjxA	0.468	0.543	1.317E-8	245	0.156	0.184	1yjxA.pdb.gz	Crystal structure of human B-type phosphoglycerate mutase bound with citrate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BX10	0.0	557	288	0.934	0.938	PGAM5_MOUSE Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Mus musculus OX=10090 GN=Pgam5 PE=1 SV=1
2	Q96HS1	0.0	594	289	1.000	1.000	PGAM5_HUMAN Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2
3	O46084	9.50e-79	242	289	0.436	0.436	PGAM5_DROME Serine/threonine-protein phosphatase Pgam5, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pgam5 PE=1 SV=1
4	Q9W173	3.08e-52	174	280	0.388	0.400	Q9W173_DROME Phosphoglycerate mutase 5-2 OS=Drosophila melanogaster OX=7227 GN=Pgam5-2 PE=4 SV=1
5	Q8I1V2	1.17e-39	142	295	0.277	0.271	Q8I1V2_PLAF7 Phosphoglucomutase-2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0413500 PE=1 SV=1
6	Q383P5	1.47e-37	136	304	0.315	0.299	Q383P5_TRYB2 Phosphoglycerate mutase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2110 PE=4 SV=1
7	Q57UA8	8.33e-06	47.8	185	0.125	0.195	Q57UA8_TRYB2 Phosphoglycerate mutase protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.310 PE=4 SV=1
8	Q12040	3.95e-05	46.2	230	0.090	0.113	YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR283W PE=1 SV=1
9	O94461	0.009	38.9	209	0.194	0.268	YFFL_SCHPO Probable phosphatase C1687.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1687.21 PE=3 SV=1
10	P74656	0.13	35.8	238	0.066	0.080	P74656_SYNY3 Sll1549 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1549 PE=4 SV=1
11	Q16877	0.25	35.4	469	0.142	0.087	F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens OX=9606 GN=PFKFB4 PE=1 SV=6
12	Q966T6	0.58	32.7	143	0.045	0.091	COF2_DICDI Cofilin-2 OS=Dictyostelium discoideum OX=44689 GN=cofC-1 PE=2 SV=1
13	P25114	0.89	33.5	469	0.073	0.045	F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus OX=10116 GN=Pfkfb4 PE=1 SV=3
14	Q6MWZ7	1.1	32.7	203	0.170	0.241	SUGPH_MYCTU Acid phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gpm2 PE=1 SV=1
15	Q5AU81	2.9	32.0	809	0.090	0.032	AFCA_EMENI Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
16	Q91348	5.4	31.2	470	0.073	0.045	F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus OX=9031 PE=2 SV=2
17	Q28901	6.6	30.8	463	0.107	0.067	F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus OX=9913 GN=PFKFB3 PE=1 SV=2
18	Q22323	7.4	30.4	283	0.055	0.057	STPP_CAEEL Steroid-phosphate phosphatase OS=Caenorhabditis elegans OX=6239 GN=T07F12.1 PE=1 SV=2
19	A0A0A0MTJ1	7.8	30.0	249	0.055	0.064	A0A0A0MTJ1_HUMAN FKBP prolyl isomerase 8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=1
20	Q04952	7.8	30.8	1785	0.076	0.012	FKS3_YEAST 1,3-beta-glucan synthase component FKS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FKS3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00300 His_Phos_1	6.6e-16	70.1	Histidine phosphatase superfamily (branch 1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438465

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000171111	0.998	Kelch-like ECH-associated protein 1
2	9606.ENSP00000302564	0.997	Bcl-2-like protein 1
3	9606.ENSP00000367284	0.988	FUN14 domain-containing protein 1
4	9606.ENSP00000308351	0.985	Mixed lineage kinase domain-like protein
5	9606.ENSP00000259808	0.977	Receptor-interacting serine/threonine-protein kinase 1
6	9606.ENSP00000449089	0.957	Dynamin-1-like protein
7	9606.ENSP00000364204	0.926	Serine/threonine-protein kinase PINK1, mitochondrial
8	9606.ENSP00000216274	0.882	Receptor-interacting serine/threonine-protein kinase 3
9	9606.ENSP00000302037	0.786	Mitochondrial fission factor
10	9606.ENSP00000262320	0.782	Axin-1
11	9606.ENSP00000325421	0.731	Presenilins-associated rhomboid-like protein, mitochondrial
12	9606.ENSP00000438346	0.702	Receptor expression-enhancing protein 1
13	9606.ENSP00000351813	0.690	E3 ubiquitin-protein ligase MARCH5
14	9606.ENSP00000380252	0.664	Nuclear factor erythroid 2-related factor 2
15	9606.ENSP00000357835	0.662	Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
16	9606.ENSP00000264414	0.648	Cullin-3
17	9606.ENSP00000441875	0.635	Prohibitin-2
18	9606.ENSP00000358510	0.625	FUN14 domain containing 2
19	9606.ENSP00000223136	0.618	Mitochondrial fission 1 protein
20	9606.ENSP00000376840	0.601	Bisphosphoglycerate mutase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity
GO:0005096	0.998	GTPase activator activity
GO:0044877	0.993	protein-containing complex binding
GO:0019899	0.491	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0070265	0.992	necrotic cell death
GO:0008152	0.976	metabolic process
GO:0012501	0.958	programmed cell death
GO:0044237	0.947	cellular metabolic process
GO:0050789	0.944	regulation of biological process
GO:0019222	0.637	regulation of metabolic process
GO:0009056	0.532	catabolic process
GO:0050794	0.507	regulation of cellular process
GO:0048519	0.416	negative regulation of biological process
GO:0044248	0.386	cellular catabolic process
GO:0048518	0.367	positive regulation of biological process
GO:0071704	0.353	organic substance metabolic process
GO:0048522	0.321	positive regulation of cellular process
GO:0044238	0.309	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005741	0.997	mitochondrial outer membrane
GO:0005634	0.801	nucleus
GO:0043233	0.655	organelle lumen
GO:0070013	0.653	intracellular organelle lumen
GO:0005829	0.482	cytosol
GO:0031981	0.411	nuclear lumen
GO:0005654	0.380	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]