StarFunc result for job id Q96HW7

User Input

>input (963 residues)
MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFA
RKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCIMDDAINILQN
EKSHQVLAQLLDTLLAIGTKLPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSL
EKSVTKDAEGLAARDVQKIIGDYFSDQDPRVRTAAIKAMLQLHERGLKLHQTIYNQACKL
LSDDYEQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLVDDAFGKICHMVSDGSWVVRV
QAAKLLGSMEQVSSHFLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSSGRKWGDDAPK
EEVDTGAVNLIESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMF
NDEIEEVRLQSIHTMRKISNNITLREDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKE
GIHLALVELLKNLTKYPTDRDSIWKCLKFLGSRHPTLVLPLVPELLSTHPFFDTAEPDMD
DPAYIAVLVLIFNAAKTCPTMPALFSDHTFRHYAYLRDSLSHLVPALRLPGRKLVSSAVS
PSIIPQEDPSQQFLQQSLERVYSLQHLDPQGAQELLEFTIRDLQRLGELQSELAGVADFS
ATYLRCQLLLIKALQEKLWNVAAPLYLKQSDLASAAAKQIMEETYKMEFMYSGVENKQVV
IIHHMRLQAKALQLIVTARTTRGLDPLFGMCEKFLQEVDFFQRYFIADLPHLQDSFVDKL
LDLMPRLMTSKPAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSG
LVVALDVDATLEHVQDPQNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSH
TAWTEACQVEVRLLLAYNSSARIPKCPWMEGGEMSPQVETSIEGTIPFSKPVKVYIMPKP
ARR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96HW7	1.000	1.000	0.000	963	1.000	1.000	Q96HW7.pdb.gz	INT4_HUMAN Integrator complex subunit 4 OS=Homo sapiens OX=9606 GN=INTS4 PE=1 SV=2
2	PDB:7cunD	0.666	0.760	5.568E-65	827	0.842	0.981	7cunD.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
3	AFDB:Q9W3E1	0.827	0.781	7.350E-51	1022	0.340	0.320	Q9W3E1.pdb.gz	INT4_DROME Integrator complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=IntS4 PE=1 SV=1
4	AFDB:Q8VZA0	0.416	0.427	1.889E-24	936	0.168	0.173	Q8VZA0.pdb.gz	SIEL_ARATH Protein SIEL OS=Arabidopsis thaliana OX=3702 GN=SIEL PE=1 SV=1
5	PDB:7bfpC	0.281	0.878	3.756E-22	298	0.308	0.997	7bfpC.pdb.gz
6	PDB:7sn8D	0.386	0.902	9.184E-19	399	0.155	0.373	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
7	AFDB:Q9NVH2	0.268	0.268	1.091E-11	962	0.116	0.116	Q9NVH2.pdb.gz	INT7_HUMAN Integrator complex subunit 7 OS=Homo sapiens OX=9606 GN=INTS7 PE=1 SV=1
8	AFDB:Q8JGR7	0.313	0.313	3.633E-11	964	0.110	0.110	Q8JGR7.pdb.gz	INT7_DANRE Integrator complex subunit 7 OS=Danio rerio OX=7955 GN=ints7 PE=2 SV=1
9	AFDB:Q9VT41	0.231	0.225	2.698E-10	1001	0.133	0.128	Q9VT41.pdb.gz	INT7_DROME Integrator complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=defl PE=1 SV=1
10	PDB:7cunG	0.260	0.274	3.635E-10	895	0.127	0.136	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
11	AFDB:Q8I0G5	0.293	0.315	8.987E-10	883	0.109	0.119	Q8I0G5.pdb.gz	COPG_DROME Coatomer subunit gamma OS=Drosophila melanogaster OX=7227 GN=gammaCOP PE=2 SV=1
12	AFDB:O49433	0.251	0.225	9.968E-9	1134	0.137	0.116	O49433.pdb.gz	O49433_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB1895 PE=1 SV=1
13	AFDB:B0R024	0.302	0.357	1.287E-8	794	0.114	0.139	B0R024.pdb.gz	B0R024_DANRE AP-1 complex subunit gamma OS=Danio rerio OX=7955 GN=fc07e03 PE=1 SV=1
14	AFDB:Q0WW26	0.295	0.317	1.384E-8	886	0.114	0.124	Q0WW26.pdb.gz	COPG_ARATH Coatomer subunit gamma OS=Arabidopsis thaliana OX=3702 GN=At4g34450 PE=1 SV=2
15	PDB:4jlqA	0.285	0.317	4.989E-8	840	0.117	0.135	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:1b3uA	0.289	0.435	1.073E-7	588	0.093	0.153	1b3uA.pdb.gz
17	PDB:3w3uA	0.268	0.255	4.287E-7	1030	0.138	0.129	3w3uA.pdb.gz
18	PDB:2q5dB	0.318	0.354	5.952E-7	845	0.128	0.146	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
19	PDB:5a1uE	0.244	0.276	8.263E-7	824	0.108	0.126	5a1uE.pdb.gz
20	PDB:3nd2A	0.306	0.335	9.218E-7	861	0.103	0.115	3nd2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96HW7	0.0	1985	963	1.000	1.000	INT4_HUMAN Integrator complex subunit 4 OS=Homo sapiens OX=9606 GN=INTS4 PE=1 SV=2
2	Q9W3E1	2.41e-168	520	1022	0.343	0.323	INT4_DROME Integrator complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=IntS4 PE=1 SV=1
3	Q8VZA0	5.49e-24	111	936	0.091	0.094	SIEL_ARATH Protein SIEL OS=Arabidopsis thaliana OX=3702 GN=SIEL PE=1 SV=1
4	Q9HFF5	0.024	41.2	1205	0.033	0.027	PDS5_SCHPO Sister chromatid cohesion protein pds5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pds5 PE=1 SV=1
5	A0A1B0GTU7	0.080	39.3	910	0.048	0.051	A0A1B0GTU7_HUMAN DNA polymerase subunit gamma-1 (Fragment) OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=1
6	H0YCV2	0.089	38.1	233	0.048	0.197	H0YCV2_HUMAN DNA polymerase gamma, catalytic subunit (Fragment) OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=2
7	F4IPA6	0.14	38.5	744	0.078	0.101	F4IPA6_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=VAC1 PE=1 SV=1
8	E5KNU5	0.16	38.5	1239	0.048	0.037	E5KNU5_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens OX=9606 GN=POLG PE=3 SV=1
9	P54098	0.16	38.5	1239	0.048	0.037	DPOG1_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=1
10	P54099	0.39	37.0	1218	0.048	0.038	DPOG1_MOUSE DNA polymerase subunit gamma-1 OS=Mus musculus OX=10090 GN=Polg PE=1 SV=3
11	Q5A352	0.57	36.6	890	0.029	0.031	Q5A352_CANAL Vacuolar protein 14 C-terminal Fig4-binding domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_CR08430WA PE=3 SV=1
12	Q9QYV8	0.79	36.2	1216	0.039	0.031	DPOG1_RAT DNA polymerase subunit gamma-1 OS=Rattus norvegicus OX=10116 GN=Polg PE=2 SV=1
13	A0A590UK63	2.5	33.9	286	0.042	0.140	A0A590UK63_HUMAN DNA polymerase gamma, catalytic subunit (Fragment) OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=1
14	Q91Z63	2.5	34.3	351	0.047	0.128	TRI63_RAT E3 ubiquitin-protein ligase TRIM63 OS=Rattus norvegicus OX=10116 GN=Trim63 PE=2 SV=1
15	Q5T1C6	3.4	33.1	240	0.023	0.092	THEM4_HUMAN Acyl-coenzyme A thioesterase THEM4 OS=Homo sapiens OX=9606 GN=THEM4 PE=1 SV=1
16	D6W5U7	3.7	33.9	1226	0.021	0.016	D6W5U7_HUMAN Cohesin subunit SA OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1
17	Q9UJ98	3.7	33.9	1225	0.021	0.016	STAG3_HUMAN Cohesin subunit SA-3 OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=2
18	A7DTF0	3.9	33.5	337	0.019	0.053	MRG1_CAEEL Mortality factor related protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrg-1 PE=1 SV=1
19	Q99M76	5.2	33.5	1256	0.025	0.019	STAG3_RAT Cohesin subunit SA-3 OS=Rattus norvegicus OX=10116 GN=Stag3 PE=2 SV=1
20	Q99570	8.6	32.7	1358	0.046	0.032	PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PIK3R4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	1.4e-09	48.8	Adaptin N terminal region
2	PF12348 CLASP_N	0.00092	30.4	CLASP N terminal
3	PF12717 Cnd1	3.6e-06	38.6	non-SMC mitotic condensation complex subunit 1
4	PF12719 Cnd3	6	17.6	Nuclear condensing complex subunits, C-term domain
5	PF12765 Cohesin_HEAT	0.0044	28.6	HEAT repeat associated with sister chromatid cohesion
6	PF02985 HEAT	7e-19	77.3	HEAT repeat
7	PF13646 HEAT_2	1.9e-16	71.6	HEAT repeats
8	PF03130 HEAT_PBS	6.2e+02	12.5	PBS lyase HEAT-like repeat
9	PF20168 PDS5	1.5e-09	48.0	Sister chromatid cohesion protein PDS5 protein
10	PF10363 RTP1_C1	13	17.4	Required for nuclear transport of RNA pol II C-terminus 1
11	PF12755 Vac14_Fab1_bd	0.0012	30.8	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434466

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429065	0.999	Integrator complex subunit 9
2	9606.ENSP00000445001	0.999	Integrator complex subunit 11
3	9606.ENSP00000327889	0.998	Integrator complex subunit 5
4	9606.ENSP00000385722	0.996	Integrator complex subunit 1
5	9606.ENSP00000355961	0.994	Integrator complex subunit 7
6	9606.ENSP00000414237	0.994	Integrator complex subunit 2
7	9606.ENSP00000430338	0.992	Integrator complex subunit 8
8	9606.ENSP00000310260	0.991	Integrator complex subunit 6
9	9606.ENSP00000318641	0.987	Integrator complex subunit 3
10	9606.ENSP00000381064	0.982	Integrator complex subunit 10
11	9606.ENSP00000261191	0.978	Integrator complex subunit 13
12	9606.ENSP00000408429	0.972	Integrator complex subunit 14
13	9606.ENSP00000415433	0.971	Integrator complex subunit 12
14	9606.ENSP00000457408	0.927	Uncharacterized protein KIAA0513
15	9606.ENSP00000418447	0.889	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
16	9606.ENSP00000480158	0.880	DNA-directed RNA polymerase II subunit RPB1
17	9606.ENSP00000427772	0.815	Protein KIBRA
18	9606.ENSP00000261778	0.771	Transport and golgi organization 6 homolog
19	9606.ENSP00000370625	0.766	DNA-directed RNA polymerase II subunit RPB2
20	9606.ENSP00000184956	0.756	HEAT repeat-containing protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0010467	0.968	gene expression
GO:0016073	0.967	snRNA metabolic process
GO:0016180	0.925	snRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0140513	0.996	nuclear protein-containing complex
GO:0005730	0.986	nucleolus
GO:0005737	0.940	cytoplasm
GO:0032039	0.662	integrator complex
GO:0016020	0.496	membrane
GO:0005829	0.356	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]