StarFunc result for job id Q96HY6

User Input

>input (314 residues)
MVAPVWYLVAAALLVGFILFLTRSRGRAASAGQEPLHNEELAGAGRVAQPGPLEPEEPRA
GGRPRRRRDLGSRLQAQRRAQRVAWAEADENEEEAVILAQEEEGVEKPAETHLSGKIGAK
KLRKLEEKQARKAQREAEEAEREERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREE
QAQREHEEYLKLKEAFVVEEEGVGETMTEEQSQSFLTEFINYIKQSKVVLLEDLASQVGL
RTQDTINRIQDLLAEGTITGVIDDRGKFIYITPEELAAVANFIRQRGRVSIAELAQASNS
LIAWGRESPAQAPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96HY6	1.000	1.000	3.941E-47	314	1.000	1.000	Q96HY6.pdb.gz	DDRGK_HUMAN DDRGK domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DDRGK1 PE=1 SV=2
2	AFDB:D3ZAS9	0.687	0.640	6.178E-38	339	0.854	0.791	D3ZAS9.pdb.gz	D3ZAS9_RAT DDRGK domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ddrgk1 PE=3 SV=1
3	AFDB:A0A0A0MRX2	0.337	0.352	2.958E-27	298	0.783	0.826	A0A0A0MRX2.pdb.gz	A0A0A0MRX2_HUMAN DDRGK domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DDRGK1 PE=1 SV=1
4	AFDB:Q6P0E5	0.432	0.450	1.629E-23	300	0.529	0.553	Q6P0E5.pdb.gz	DDRGK_DANRE DDRGK domain-containing protein 1 OS=Danio rerio OX=7955 GN=ddrgk1 PE=2 SV=1
5	AFDB:Q9VDD1	0.380	0.384	2.406E-19	309	0.401	0.408	Q9VDD1.pdb.gz	DDRGK_DROME DDRGK domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=CG5862 PE=1 SV=1
6	AFDB:P34623	0.358	0.369	5.656E-19	302	0.366	0.381	P34623.pdb.gz	DDRGK_CAEEL DDRGK domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=ufbp-1 PE=3 SV=3
7	AFDB:Q94C53	0.302	0.318	5.635E-16	298	0.325	0.342	Q94C53.pdb.gz	DDRGK_ARATH DDRGK domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27120 PE=2 SV=1
8	AFDB:Q38BR4	0.386	0.355	6.390E-11	349	0.255	0.229	Q38BR4.pdb.gz	Q38BR4_TRYB2 DDRGK domain-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4110 PE=4 SV=1
9	PDB:6fvtR	0.194	0.152	1.222E-2	405	0.045	0.035	6fvtR.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
10	PDB:4d10H	0.171	0.286	1.813E-2	173	0.041	0.075	4d10H.pdb.gz	Crystal Structure of the Human Cop9 Signalosome
11	PDB:3txmA	0.189	0.169	2.519E-2	353	0.025	0.023	3txmA.pdb.gz
12	PDB:3j8bM	0.178	0.306	2.873E-2	176	0.051	0.091	3j8bM.pdb.gz
13	PDB:4zzlA	0.177	0.355	3.068E-2	146	0.054	0.116	4zzlA.pdb.gz
14	PDB:5aj0BZ	0.161	0.490	3.068E-2	86	0.035	0.128	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:4v6iAV	0.182	0.547	3.499E-2	85	0.029	0.106	4v6iAV.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
16	PDB:2h09A	0.151	0.334	3.737E-2	127	0.054	0.134	2h09A.pdb.gz
17	PDB:6r7nB	0.192	0.141	4.552E-2	443	0.057	0.041	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
18	PDB:3jckD	0.184	0.153	4.861E-2	384	0.045	0.036	3jckD.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
19	AFDB:P36188	0.099	0.113	1.695E-1	269	0.134	0.156	P36188.pdb.gz	TNNI_DROME Troponin I OS=Drosophila melanogaster OX=7227 GN=wupA PE=2 SV=3
20	AFDB:Q9N4U5	0.124	0.071	2.515E-1	547	0.185	0.106	Q9N4U5.pdb.gz	SMU2_CAEEL Smu-2 suppressor of mec-8 and unc-52 protein OS=Caenorhabditis elegans OX=6239 GN=smu-2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96HY6	0.0	611	314	1.000	1.000	DDRGK_HUMAN DDRGK domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DDRGK1 PE=1 SV=2
2	A0A0A0MRX2	6.23e-165	462	298	0.774	0.815	A0A0A0MRX2_HUMAN DDRGK domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DDRGK1 PE=1 SV=1
3	Q80WW9	8.02e-146	414	315	0.844	0.841	DDRGK_MOUSE DDRGK domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ddrgk1 PE=1 SV=2
4	D3ZAS9	6.30e-144	410	339	0.854	0.791	D3ZAS9_RAT DDRGK domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ddrgk1 PE=3 SV=1
5	Q6P0E5	2.90e-73	229	300	0.548	0.573	DDRGK_DANRE DDRGK domain-containing protein 1 OS=Danio rerio OX=7955 GN=ddrgk1 PE=2 SV=1
6	Q9VDD1	4.65e-51	172	309	0.334	0.340	DDRGK_DROME DDRGK domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=CG5862 PE=1 SV=1
7	P34623	4.99e-34	128	302	0.191	0.199	DDRGK_CAEEL DDRGK domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=ufbp-1 PE=3 SV=3
8	Q94C53	6.58e-29	114	298	0.242	0.255	DDRGK_ARATH DDRGK domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27120 PE=2 SV=1
9	Q38BR4	4.04e-14	74.3	349	0.210	0.189	Q38BR4_TRYB2 DDRGK domain-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4110 PE=4 SV=1
10	Q8IDX6	2.60e-09	60.8	3130	0.137	0.014	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
11	Q8I4Z1	5.25e-08	56.6	1846	0.124	0.021	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
12	Q8SX83	2.32e-04	45.4	5560	0.124	0.007	SPEN_DROME Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2
13	C0H5F4	5.10e-04	44.3	3254	0.108	0.010	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
14	Q5T5Y3	0.019	39.3	1602	0.099	0.019	CAMP1_HUMAN Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2
15	D3Z8E6	0.043	38.1	1604	0.099	0.019	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
16	Q8IHP3	0.056	37.7	2055	0.076	0.012	Q8IHP3_PLAF7 Membrane associated erythrocyte binding-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1147800.1 PE=4 SV=1
17	Q94185	0.19	35.8	1254	0.099	0.025	Q94185_CAEEL DumPY: shorter than wild-type OS=Caenorhabditis elegans OX=6239 GN=dpy-6 PE=1 SV=2
18	Q1MTN9	0.29	35.4	544	0.102	0.059	RLF2_SCHPO Chromatin assembly factor 1 subunit rlf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rlf2 PE=1 SV=2
19	Q54P24	0.45	34.7	1215	0.086	0.022	Q54P24_DICDI DH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcC PE=4 SV=1
20	C0H4R1	0.74	34.3	2279	0.057	0.008	C0H4R1_PLAF7 Adenylyl cyclase beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0802600 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09756 DDRGK	2.9e-67	237.4	DDRGK domain
2	PF01399 PCI	60	15.6	PCI domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346483

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358283	0.991	E3 UFM1-protein ligase 1
2	9606.ENSP00000438886	0.991	CDK5 regulatory subunit-associated protein 3
3	9606.ENSP00000368970	0.978	Ubiquitin-fold modifier 1
4	9606.ENSP00000264689	0.956	Ufm1-specific protease 2
5	9606.ENSP00000356982	0.940	Ubiquitin-fold modifier-conjugating enzyme 1
6	9606.ENSP00000328023	0.914	Signal recognition particle receptor subunit alpha
7	9606.ENSP00000348565	0.891	Ubiquitin-like modifier-activating enzyme 5
8	9606.ENSP00000373413	0.873	Inactive Ufm1-specific protease 1
9	9606.ENSP00000418401	0.769	Signal recognition particle receptor subunit beta
10	9606.ENSP00000262225	0.682	Transmembrane emp24 domain-containing protein 2
11	9606.ENSP00000303145	0.672	Transmembrane emp24 domain-containing protein 10
12	9606.ENSP00000312066	0.642	Signal recognition particle subunit SRP68
13	9606.ENSP00000342181	0.624	Signal recognition particle subunit SRP72
14	9606.ENSP00000302978	0.607	Protein sprouty homolog 3
15	9606.ENSP00000355589	0.601	Signal-induced proliferation-associated 1-like protein 2
16	9606.ENSP00000385527	0.583	Major facilitator superfamily domain-containing protein 2B
17	9606.ENSP00000422067	0.580	FAM47E-STBD1 readthrough
18	9606.ENSP00000409423	0.566	Protein FAM47E
19	9606.ENSP00000219139	0.561	UPF0183 protein C16orf70
20	9606.ENSP00000261517	0.527	Vacuolar protein sorting-associated protein 13C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140297	0.933	DNA-binding transcription factor binding
GO:0044389	0.926	ubiquitin-like protein ligase binding
GO:0061629	0.924	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0048583	0.987	regulation of response to stimulus
GO:0048523	0.984	negative regulation of cellular process
GO:0048518	0.963	positive regulation of biological process
GO:0032501	0.951	multicellular organismal process
GO:0034976	0.942	response to endoplasmic reticulum stress
GO:0032502	0.940	developmental process
GO:0048856	0.928	anatomical structure development
GO:1903573	0.911	negative regulation of response to endoplasmic reticulum stress
GO:0009966	0.902	regulation of signal transduction
GO:0048522	0.900	positive regulation of cellular process
GO:0009894	0.859	regulation of catabolic process
GO:0008152	0.826	metabolic process
GO:0031323	0.809	regulation of cellular metabolic process
GO:1900101	0.799	regulation of endoplasmic reticulum unfolded protein response
GO:0060255	0.784	regulation of macromolecule metabolic process
GO:0051171	0.782	regulation of nitrogen compound metabolic process
GO:0080090	0.781	regulation of primary metabolic process
GO:0044238	0.780	primary metabolic process
GO:0009968	0.779	negative regulation of signal transduction
GO:0071704	0.778	organic substance metabolic process
GO:0051246	0.743	regulation of protein metabolic process
GO:0031329	0.734	regulation of cellular catabolic process
GO:0042176	0.719	regulation of protein catabolic process
GO:0007275	0.713	multicellular organism development
GO:0006807	0.710	nitrogen compound metabolic process
GO:1903050	0.660	regulation of proteolysis involved in protein catabolic process
GO:2000058	0.634	regulation of ubiquitin-dependent protein catabolic process
GO:0009888	0.632	tissue development
GO:0061448	0.616	connective tissue development
GO:0009892	0.608	negative regulation of metabolic process
GO:0044237	0.596	cellular metabolic process
GO:0071840	0.588	cellular component organization or biogenesis
GO:0061136	0.588	regulation of proteasomal protein catabolic process
GO:0051248	0.582	negative regulation of protein metabolic process
GO:0001501	0.576	skeletal system development
GO:0016043	0.531	cellular component organization
GO:1901564	0.526	organonitrogen compound metabolic process
GO:0043170	0.515	macromolecule metabolic process
GO:0032434	0.498	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0019538	0.489	protein metabolic process
GO:0009893	0.478	positive regulation of metabolic process
GO:0022411	0.474	cellular component disassembly
GO:0006996	0.470	organelle organization
GO:0051179	0.463	localization
GO:0010604	0.435	positive regulation of macromolecule metabolic process
GO:0009895	0.434	negative regulation of catabolic process
GO:0070647	0.421	protein modification by small protein conjugation or removal
GO:0044248	0.420	cellular catabolic process
GO:0032879	0.410	regulation of localization
GO:0048513	0.386	animal organ development
GO:0008104	0.354	protein localization
GO:0031324	0.347	negative regulation of cellular metabolic process
GO:0060341	0.324	regulation of cellular localization
GO:0051173	0.319	positive regulation of nitrogen compound metabolic process
GO:0031325	0.319	positive regulation of cellular metabolic process
GO:0010468	0.315	regulation of gene expression
GO:0045861	0.313	negative regulation of proteolysis
GO:0032880	0.303	regulation of protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0031981	0.999	nuclear lumen
GO:0016020	0.994	membrane
GO:0031090	0.961	organelle membrane
GO:0031984	0.955	organelle subcompartment
GO:0005789	0.952	endoplasmic reticulum membrane
GO:0005730	0.871	nucleolus
GO:0005654	0.532	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]