StarFunc result for job id Q96HZ4

User Input

>input (224 residues)
MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT
VAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDD
LCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96HZ4	0.999	0.999	3.446E-33	224	1.000	1.000	Q96HZ4.pdb.gz	HES6_HUMAN Transcription cofactor HES-6 OS=Homo sapiens OX=9606 GN=HES6 PE=1 SV=1
2	AFDB:Q9JHE6	0.730	0.730	1.145E-25	224	0.857	0.857	Q9JHE6.pdb.gz	HES6_MOUSE Transcription cofactor HES-6 OS=Mus musculus OX=10090 GN=Hes6 PE=1 SV=1
3	AFDB:F1QMG5	0.588	0.583	1.878E-16	226	0.536	0.531	F1QMG5.pdb.gz
4	AFDB:A1L3K9	0.503	0.507	2.416E-14	222	0.496	0.500	A1L3K9.pdb.gz	A1L3K9_XENLA LOC100037036 protein (Fragment) OS=Xenopus laevis OX=8355 GN=LOC100037036 PE=2 SV=1
5	AFDB:F1QI81	0.267	0.270	8.076E-10	221	0.357	0.362	F1QI81.pdb.gz	F1QI81_DANRE Hairy-related 8a OS=Danio rerio OX=7955 GN=her-8a PE=4 SV=2
6	AFDB:O57337	0.333	0.261	4.255E-9	290	0.321	0.248	O57337.pdb.gz	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
7	AFDB:Q90468	0.292	0.200	5.856E-9	334	0.312	0.210	Q90468.pdb.gz
8	AFDB:P35428	0.323	0.261	6.655E-9	282	0.330	0.262	P35428.pdb.gz	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
9	AFDB:Q9HCC6	0.322	0.326	1.527E-8	221	0.304	0.308	Q9HCC6.pdb.gz	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
10	AFDB:Q6IRB2	0.342	0.293	2.241E-8	267	0.304	0.255	Q6IRB2.pdb.gz	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
11	PDB:7wtww	0.113	0.086	4.372	332	0.121	0.081	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
12	PDB:1rm1C	0.173	0.292	5.645	116	0.058	0.112	1rm1C.pdb.gz	High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
13	PDB:7egdD	0.135	0.150	6.018	197	0.080	0.091	7egdD.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
14	PDB:4efcA	0.097	0.049	6.838	452	0.036	0.018	4efcA.pdb.gz	Crystal Structure of Adenylosuccinate Lyase from Trypanosoma Brucei, Tb427tmp.160.5560
15	PDB:7msct	0.173	0.396	6.838	85	0.054	0.141	7msct.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
16	PDB:7wooD	0.150	0.029	6.838	1398	0.085	0.014	7wooD.pdb.gz
17	PDB:7abgA4	0.203	0.120	7.290	405	0.107	0.059	7abgA4.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
18	PDB:1a6rA	0.136	0.074	7.771	459	0.022	0.011	1a6rA.pdb.gz
19	PDB:3wqyA	0.164	0.053	7.771	905	0.062	0.015	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
20	PDB:6v8oO	0.112	0.072	8.284	384	0.027	0.016	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96HZ4	1.21e-159	442	224	1.000	1.000	HES6_HUMAN Transcription cofactor HES-6 OS=Homo sapiens OX=9606 GN=HES6 PE=1 SV=1
2	Q9JHE6	1.12e-125	356	224	0.857	0.857	HES6_MOUSE Transcription cofactor HES-6 OS=Mus musculus OX=10090 GN=Hes6 PE=1 SV=1
3	Q6P0J1	4.33e-71	218	226	0.527	0.522	Q6P0J1_DANRE Hairy and enhancer of split 6 (Drosophila) OS=Danio rerio OX=7955 GN=her13.2 PE=1 SV=1
4	A1L3K9	2.27e-63	198	222	0.504	0.509	A1L3K9_XENLA LOC100037036 protein (Fragment) OS=Xenopus laevis OX=8355 GN=LOC100037036 PE=2 SV=1
5	F1QI81	1.68e-30	114	221	0.250	0.253	F1QI81_DANRE Hairy-related 8a OS=Danio rerio OX=7955 GN=her-8a PE=4 SV=2
6	Q6XLQ0	1.61e-20	89.4	290	0.196	0.152	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
7	O57337	2.55e-20	89.0	290	0.196	0.152	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
8	Q9DF41	2.65e-20	89.0	291	0.192	0.148	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
9	Q90VV1	3.07e-20	88.6	277	0.335	0.271	HES4B_XENLA Transcription factor HES-4-B OS=Xenopus laevis OX=8355 GN=hes4-b PE=1 SV=1
10	Q6PBX3	4.90e-20	87.8	270	0.308	0.256	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
11	Q14469	8.44e-20	87.4	280	0.192	0.154	HES1_HUMAN Transcription factor HES-1 OS=Homo sapiens OX=9606 GN=HES1 PE=1 SV=1
12	Q04666	9.21e-20	87.0	281	0.192	0.153	HES1_RAT Transcription factor HES-1 OS=Rattus norvegicus OX=10116 GN=Hes1 PE=1 SV=1
13	Q90Z12	9.89e-20	87.0	281	0.330	0.263	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
14	P35428	1.78e-19	86.3	282	0.192	0.152	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
15	Q6IRB2	3.44e-19	85.5	267	0.290	0.243	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
16	Q9HCC6	5.05e-17	78.6	221	0.183	0.186	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
17	Q26263	1.12e-16	80.1	435	0.188	0.097	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
18	P13097	1.40e-13	68.6	186	0.188	0.226	ESM7_DROME Enhancer of split m7 protein OS=Drosophila melanogaster OX=7227 GN=E(spl)m7-HLH PE=1 SV=1
19	Q01070	1.27e-12	66.2	205	0.188	0.205	ESMC_DROME Enhancer of split mgamma protein OS=Drosophila melanogaster OX=7227 GN=E(spl)mgamma-HLH PE=1 SV=1
20	P35429	1.85e-12	65.1	157	0.201	0.287	HES2_RAT Transcription factor HES-2 OS=Rattus norvegicus OX=10116 GN=Hes2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07527 Hairy_orange	1.3e-08	46.3	Hairy Orange
2	PF00010 HLH	3.6e-08	44.6	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272937

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232424	0.931	Transcription factor HES-1
2	9606.ENSP00000365682	0.849	Transducin-like enhancer protein 1
3	9606.ENSP00000321445	0.764	Musculin
4	9606.ENSP00000367714	0.744	Transcription factor HES-5
5	9606.ENSP00000217244	0.724	Casein kinase II subunit alpha
6	9606.ENSP00000266744	0.651	Achaete-scute homolog 1
7	9606.ENSP00000277541	0.626	Neurogenic locus notch homolog protein 1
8	9606.ENSP00000262367	0.606	CREB-binding protein
9	9606.ENSP00000250003	0.604	Myoblast determination protein 1
10	9606.ENSP00000262506	0.604	Casein kinase II subunit alpha
11	9606.ENSP00000355718	0.595	Delta-like protein 1
12	9606.ENSP00000367130	0.557	Transcription factor HES-3
13	9606.ENSP00000205143	0.545	Delta-like protein 3
14	9606.ENSP00000466542	0.536	Transducin-like enhancer protein 2
15	9606.ENSP00000400341	0.531	Hepatocyte nuclear factor 3-beta
16	9606.ENSP00000342392	0.527	Mesoderm posterior protein 2
17	9606.ENSP00000246104	0.515	Transcriptional repressor scratch 2
18	9606.ENSP00000256646	0.509	Neurogenic locus notch homolog protein 2
19	9606.ENSP00000302216	0.509	Protein atonal homolog 1
20	9606.ENSP00000312987	0.503	Hepatocyte nuclear factor 4-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000981	0.933	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.839	transcription factor binding
GO:0000976	0.773	transcription cis-regulatory region binding
GO:0000977	0.673	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140297	0.619	DNA-binding transcription factor binding
GO:0001227	0.519	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	0.468	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.996	regulation of DNA-templated transcription
GO:0032502	0.902	developmental process
GO:0048856	0.880	anatomical structure development
GO:0009987	0.774	cellular process
GO:0032501	0.742	multicellular organismal process
GO:0048519	0.740	negative regulation of biological process
GO:0048523	0.718	negative regulation of cellular process
GO:0010605	0.634	negative regulation of macromolecule metabolic process
GO:0051172	0.622	negative regulation of nitrogen compound metabolic process
GO:0031324	0.621	negative regulation of cellular metabolic process
GO:0007275	0.602	multicellular organism development
GO:0045892	0.585	negative regulation of DNA-templated transcription
GO:0006357	0.548	regulation of transcription by RNA polymerase II
GO:0048731	0.449	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.995	protein-containing complex
GO:0005667	0.964	transcription regulator complex
GO:0110165	0.952	cellular anatomical entity
GO:0005634	0.908	nucleus
GO:0031981	0.338	nuclear lumen
GO:0005654	0.319	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]