StarFunc result for job id Q96I34

User Input

>input (528 residues)
MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAAS
QGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMV
QQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDE
QTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAA
ANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDET
PLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVRRVSLTQRTDL
YRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPV
RHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPE
TAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96I34	1.000	1.000	2.273E-69	528	1.000	1.000	Q96I34.pdb.gz	PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens OX=9606 GN=PPP1R16A PE=1 SV=1
2	AFDB:Q923M0	0.597	0.601	8.634E-54	524	0.824	0.830	Q923M0.pdb.gz	PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus OX=10090 GN=Ppp1r16a PE=1 SV=1
3	AFDB:Q8VHQ3	0.634	0.592	4.683E-37	568	0.494	0.460	Q8VHQ3.pdb.gz	PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus OX=10090 GN=Ppp1r16b PE=1 SV=1
4	AFDB:M9PFV2	0.517	0.434	6.577E-32	635	0.394	0.328	M9PFV2.pdb.gz	M9PFV2_DROME Myosin phosphatase targeting subunit 75D, isoform B OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=4 SV=1
5	AFDB:Q8SY34	0.524	0.386	7.138E-30	741	0.394	0.281	Q8SY34.pdb.gz	Q8SY34_DROME LD46604p OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=2 SV=1
6	AFDB:M9NDA1	0.458	0.213	5.246E-21	1230	0.282	0.121	M9NDA1.pdb.gz	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
7	AFDB:Q86RA0	0.459	0.277	5.246E-21	927	0.284	0.162	Q86RA0.pdb.gz	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
8	AFDB:O60237	0.481	0.275	2.908E-20	982	0.271	0.146	O60237.pdb.gz	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
9	AFDB:M9NEB2	0.465	0.210	3.811E-20	1273	0.282	0.117	M9NEB2.pdb.gz	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
10	AFDB:Q86R99	0.467	0.323	3.811E-20	797	0.277	0.183	Q86R99.pdb.gz	Q86R99_DROME Myosin phosphatase DMBS-S OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
11	PDB:2dvwA	0.194	0.432	4.801E-11	229	0.129	0.297	2dvwA.pdb.gz
12	PDB:8cs9A	0.213	0.143	1.354E-10	796	0.133	0.088	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:6v9hC	0.190	0.361	2.761E-8	270	0.114	0.222	6v9hC.pdb.gz
14	PDB:4oauC	0.196	0.162	3.306E-8	692	0.117	0.090	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:1wg0A	0.210	0.436	8.142E-8	243	0.104	0.226	1wg0A.pdb.gz
16	PDB:6jd6B	0.163	0.428	2.296E-7	192	0.102	0.281	6jd6B.pdb.gz
17	PDB:6mwqA	0.165	0.176	6.771E-7	493	0.116	0.124	6mwqA.pdb.gz
18	PDB:5vkqA	0.195	0.081	1.016E-6	1499	0.119	0.042	5vkqA.pdb.gz
19	PDB:6aunA	0.181	0.155	1.158E-5	618	0.106	0.091	6aunA.pdb.gz
20	PDB:1bd8A	0.175	0.553	1.901E-5	156	0.095	0.321	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q923M0	0.0	858	524	0.824	0.830	PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus OX=10090 GN=Ppp1r16a PE=1 SV=1
2	Q96I34	0.0	1068	528	1.000	1.000	PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens OX=9606 GN=PPP1R16A PE=1 SV=1
3	Q8VHQ3	7.80e-165	481	568	0.515	0.479	PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus OX=10090 GN=Ppp1r16b PE=1 SV=1
4	Q96T49	6.63e-164	479	567	0.515	0.480	PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens OX=9606 GN=PPP1R16B PE=1 SV=1
5	Q95N27	9.92e-164	478	568	0.519	0.482	PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus OX=9913 GN=PPP1R16B PE=1 SV=1
6	M9PFV2	1.45e-102	323	635	0.375	0.312	M9PFV2_DROME Myosin phosphatase targeting subunit 75D, isoform B OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=4 SV=1
7	Q8SY34	5.61e-102	325	741	0.375	0.267	Q8SY34_DROME LD46604p OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=2 SV=1
8	M9NFZ0	6.73e-56	192	341	0.225	0.349	M9NFZ0_DROME Myosin binding subunit, isoform P OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
9	O60237	1.29e-55	203	982	0.235	0.126	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
10	Q90623	1.80e-54	200	1004	0.237	0.125	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
11	F8VZN8	6.10e-54	195	692	0.231	0.176	F8VZN8_HUMAN Protein phosphatase 1 regulatory subunit 12A (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
12	A8JNT4	7.53e-54	197	925	0.241	0.137	A8JNT4_DROME Myosin binding subunit, isoform H OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
13	A8JNT5	8.54e-54	196	795	0.222	0.147	A8JNT5_DROME Myosin binding subunit, isoform G OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
14	Q86R99	8.70e-54	196	797	0.222	0.147	Q86R99_DROME Myosin phosphatase DMBS-S OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
15	Q86RA0	9.32e-54	197	927	0.241	0.137	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
16	M9NDS8	1.28e-53	197	1245	0.241	0.102	M9NDS8_DROME Myosin binding subunit, isoform N OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
17	Q9VUX6	1.41e-53	196	860	0.222	0.136	Q9VUX6_DROME Myosin binding subunit, isoform K OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=3
18	Q10728	1.55e-53	197	1032	0.231	0.118	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
19	E1BC59	1.95e-53	197	1028	0.231	0.119	E1BC59_BOVIN Protein phosphatase 1 regulatory subunit OS=Bos taurus OX=9913 GN=PPP1R12A PE=4 SV=3
20	M9PCQ3	2.05e-53	197	1111	0.222	0.105	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	5.7e-19	78.9	Ankyrin repeat
2	PF12796 Ank_2	1.8e-25	100.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	8e-17	70.5	Ankyrin repeat
4	PF13637 Ank_4	1.1e-23	94.6	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.2e-17	74.1	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292539

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378769	0.893	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
2	9606.ENSP00000341779	0.840	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
3	9606.ENSP00000387426	0.778	Cysteine and histidine rich 1
4	9606.ENSP00000313922	0.742	Ornithine decarboxylase antizyme 3
5	9606.ENSP00000435565	0.722	Maestro heat like repeat family member 1
6	9606.ENSP00000335153	0.686	Heat shock protein HSP 90-alpha
7	9606.ENSP00000480053	0.605	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
8	9606.ENSP00000292524	0.598	Leucine-rich repeat-containing protein 14
9	9606.ENSP00000366522	0.583	Rho GTPase activating protein 39
10	9606.ENSP00000406463	0.583	DnaJ homolog subfamily C member 7
11	9606.ENSP00000334940	0.579	Gametogenetin
12	9606.ENSP00000341528	0.547	Zinc finger protein 34
13	9606.ENSP00000314380	0.537	Protein lifeguard 1
14	9606.ENSP00000326031	0.532	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
15	9606.ENSP00000484669	0.529	Cleavage and polyadenylation specificity factor subunit 1
16	9606.ENSP00000310547	0.525	Uncharacterized aarF domain-containing protein kinase 5
17	9606.ENSP00000301332	0.509	Kinesin-like protein KIFC2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048583	0.454	regulation of response to stimulus
GO:0008152	0.425	metabolic process
GO:0032501	0.385	multicellular organismal process
GO:0050896	0.384	response to stimulus
GO:0071840	0.370	cellular component organization or biogenesis
GO:0032502	0.359	developmental process
GO:0044238	0.352	primary metabolic process
GO:0071704	0.324	organic substance metabolic process
GO:0048856	0.302	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.983	cytosol
GO:0043227	0.975	membrane-bounded organelle
GO:0043231	0.942	intracellular membrane-bounded organelle
GO:0005634	0.831	nucleus
GO:0070013	0.708	intracellular organelle lumen
GO:0071944	0.641	cell periphery
GO:0005886	0.626	plasma membrane
GO:0031981	0.551	nuclear lumen
GO:0005654	0.478	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]