StarFunc result for job id Q96I59

User Input

>input (477 residues)
MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVL
FLHVNDGSSLESLQVVADSGLDSRELNFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGN
CDAKDFPIKYKERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHT
PIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGP
TFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHK
FIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCG
NIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLA
RSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96I59	1.000	1.000	8.573E-100	477	1.000	1.000	Q96I59.pdb.gz	SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=NARS2 PE=1 SV=3
2	AFDB:Q8BGV0	0.968	0.968	9.647E-86	477	0.845	0.845	Q8BGV0.pdb.gz	SYNM_MOUSE Probable asparagine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Nars2 PE=1 SV=1
3	AFDB:O48593	0.901	0.761	1.709E-57	567	0.463	0.390	O48593.pdb.gz	SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SYNO PE=2 SV=3
4	AFDB:O51128	0.903	0.932	5.855E-57	462	0.413	0.426	O51128.pdb.gz	SYN_BORBU Asparagine--tRNA ligase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=asnS PE=3 SV=2
5	AFDB:P0A8M0	0.902	0.922	1.505E-55	466	0.400	0.410	P0A8M0.pdb.gz	SYN_ECOLI Asparagine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=asnS PE=1 SV=2
6	AFDB:Q7JZR5	0.877	0.908	5.681E-53	460	0.377	0.391	Q7JZR5.pdb.gz	Q7JZR5_DROME asparagine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=AsnRS-m PE=1 SV=1
7	AFDB:Q9SW96	0.896	0.750	5.638E-52	572	0.447	0.372	Q9SW96.pdb.gz	SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana OX=3702 GN=SYNC1 PE=1 SV=1
8	AFDB:Q9P6I0	0.827	0.892	2.398E-50	441	0.396	0.429	Q9P6I0.pdb.gz	SYNM_SCHPO Asparagine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slm5 PE=3 SV=1
9	AFDB:O96198	0.871	0.685	5.553E-50	610	0.398	0.311	O96198.pdb.gz	O96198_PLAF7 asparagine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0211800 PE=3 SV=1
10	AFDB:P25345	0.875	0.849	7.711E-49	492	0.363	0.352	P25345.pdb.gz	SYNM_YEAST Asparagine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLM5 PE=1 SV=1
11	PDB:5zg8A	0.798	0.897	4.892E-40	422	0.294	0.332	5zg8A.pdb.gz
12	PDB:4j15A	0.700	0.769	1.838E-29	431	0.214	0.237	4j15A.pdb.gz
13	PDB:1e1tA	0.668	0.658	2.833E-27	485	0.168	0.165	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
14	PDB:1bbuA	0.675	0.663	7.337E-27	486	0.170	0.167	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
15	PDB:6chdA	0.690	0.653	3.145E-26	506	0.182	0.172	6chdA.pdb.gz	Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine
16	PDB:5w25A	0.670	0.555	1.686E-25	583	0.226	0.185	5w25A.pdb.gz	Crystal structure of Aspartyl-tRNA synthetase from Mycobacterium tuberculosis complexed with L-Aspartic Acid
17	PDB:1eqrA	0.680	0.556	2.495E-25	590	0.210	0.169	1eqrA.pdb.gz
18	PDB:4ah6A	0.649	0.533	1.045E-21	589	0.205	0.166	4ah6A.pdb.gz
19	PDB:3a5zC	0.476	0.681	4.049E-15	324	0.124	0.182	3a5zC.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
20	PDB:3a5yA	0.454	0.708	5.946E-14	297	0.124	0.199	3a5yA.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BGV0	0.0	853	477	0.845	0.845	SYNM_MOUSE Probable asparagine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Nars2 PE=1 SV=1
2	Q96I59	0.0	988	477	1.000	1.000	SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=NARS2 PE=1 SV=3
3	O48593	1.25e-137	409	567	0.457	0.384	SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SYNO PE=2 SV=3
4	O51128	2.24e-135	400	462	0.407	0.420	SYN_BORBU Asparagine--tRNA ligase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=asnS PE=3 SV=2
5	P0A8M0	1.81e-124	372	466	0.407	0.416	SYN_ECOLI Asparagine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=asnS PE=1 SV=2
6	Q7JZR5	9.66e-114	345	460	0.373	0.387	Q7JZR5_DROME asparagine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=AsnRS-m PE=1 SV=1
7	Q9P6I0	5.58e-112	339	441	0.396	0.429	SYNM_SCHPO Asparagine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slm5 PE=3 SV=1
8	P25345	2.27e-95	298	492	0.363	0.352	SYNM_YEAST Asparagine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLM5 PE=1 SV=1
9	Q9SW96	7.23e-82	266	572	0.287	0.240	SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana OX=3702 GN=SYNC1 PE=1 SV=1
10	Q97PR0	3.58e-75	244	447	0.317	0.338	SYN_STRPN Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=asnS PE=1 SV=1
11	O96198	9.28e-75	248	610	0.264	0.207	O96198_PLAF7 asparagine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0211800 PE=3 SV=1
12	P54263	8.87e-71	233	438	0.314	0.342	SYN_THET8 Asparagine--tRNA ligase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=asnS PE=1 SV=2
13	Q8I408	1.16e-60	213	722	0.224	0.148	Q8I408_PLAF7 asparagine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0509600 PE=4 SV=1
14	P38707	2.90e-60	208	554	0.279	0.240	SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DED81 PE=1 SV=1
15	Q9SW95	7.85e-60	209	638	0.258	0.193	SYNC2_ARATH Asparagine--tRNA ligase, cytoplasmic 2 OS=Arabidopsis thaliana OX=3702 GN=SYNC2 PE=1 SV=2
16	Q8BP47	1.22e-57	201	559	0.304	0.259	SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=NARS1 PE=1 SV=2
17	Q19722	2.90e-57	200	545	0.291	0.255	SYNC_CAEEL Asparagine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=nars-1 PE=3 SV=1
18	Q554D9	2.01e-54	194	653	0.296	0.216	SYNC_DICDI Asparagine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=asnS1 PE=1 SV=1
19	Q584F6	2.09e-53	193	746	0.281	0.180	Q584F6_TRYB2 asparagine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.630 PE=4 SV=1
20	O43776	4.62e-52	186	548	0.304	0.265	SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00152 tRNA-synt_2	4.9e-94	326.5	tRNA synthetases class II (D, K and N)
2	PF00587 tRNA-synt_2b	1.1e+02	14.2	tRNA synthetase class II core domain (G, H, P, S and T)
3	PF01409 tRNA-synt_2d	0.57	21.2	tRNA synthetases class II core domain (F)
4	PF01336 tRNA_anti-codon	1.7e-05	36.0	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281038

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263985	0.984	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
2	9606.ENSP00000358042	0.983	Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
3	9606.ENSP00000307567	0.954	Glutamine--tRNA ligase
4	9606.ENSP00000262027	0.951	Methionine--tRNA ligase, cytoplasmic
5	9606.ENSP00000355889	0.945	Isoleucine--tRNA ligase, mitochondrial
6	9606.ENSP00000362576	0.940	Tyrosine--tRNA ligase, cytoplasmic
7	9606.ENSP00000360327	0.939	Probable proline--tRNA ligase, mitochondrial
8	9606.ENSP00000408576	0.936	Probable leucine--tRNA ligase, mitochondrial
9	9606.ENSP00000395196	0.926	Probable glutamate--tRNA ligase, mitochondrial
10	9606.ENSP00000355890	0.924	Bifunctional glutamate/proline--tRNA ligase
11	9606.ENSP00000320658	0.913	Tyrosine--tRNA ligase, mitochondrial
12	9606.ENSP00000235521	0.912	Tryptophan--tRNA ligase, mitochondrial
13	9606.ENSP00000446872	0.911	Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
14	9606.ENSP00000358549	0.910	Probable arginine--tRNA ligase, mitochondrial
15	9606.ENSP00000364794	0.903	Isoleucine--tRNA ligase, cytoplasmic
16	9606.ENSP00000472847	0.894	Serine--tRNA ligase, mitochondrial
17	9606.ENSP00000261772	0.887	Alanine--tRNA ligase, cytoplasmic
18	9606.ENSP00000316335	0.883	Phenylalanine--tRNA ligase, mitochondrial
19	9606.ENSP00000230771	0.876	Probable histidine--tRNA ligase, mitochondrial
20	9606.ENSP00000358060	0.875	Threonine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0004812	0.987	aminoacyl-tRNA ligase activity
GO:1901363	0.979	heterocyclic compound binding
GO:0097159	0.973	organic cyclic compound binding
GO:0003723	0.942	RNA binding
GO:0000049	0.879	tRNA binding
GO:0005515	0.815	protein binding
GO:0004816	0.694	asparagine-tRNA ligase activity
GO:0005524	0.644	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901576	0.996	organic substance biosynthetic process
GO:0044249	0.996	cellular biosynthetic process
GO:0006520	0.996	amino acid metabolic process
GO:0006399	0.996	tRNA metabolic process
GO:0010467	0.995	gene expression
GO:0044260	0.995	cellular macromolecule metabolic process
GO:0019538	0.995	protein metabolic process
GO:0006418	0.989	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.996	intracellular organelle lumen
GO:0031981	0.986	nuclear lumen
GO:0005829	0.972	cytosol
GO:0005654	0.944	nucleoplasm
GO:0005759	0.328	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	0.987	Ligases forming aminoacyl-tRNA and related compounds.
RHEA:11180	0.694	ATP + L-asparagine + tRNA(Asn) = AMP + diphosphate + H(+) + L-asparaginyl-tRNA(Asn)
EC:6.1.1.22	0.694	asparagine--tRNA ligase.

[back to server]