StarFunc result for job id Q96I76

User Input

>input (525 residues)
MAVPGEAEEEATVYLVVSGIPSVLRSAHLRSYFSQFREERGGGFLCFHYRHRPERAPPQA
APNSALIPTDPAAEGQLLSQTSATDVRPLSTRDSTPIQTRTCCCVISVRGLAQAQRLIRM
YSGRRWLDSHGTWLPGRCLIRRLRLPTEASGLGSFPFKTRKELQSWKAENEAFTLADLKQ
LPELNPPVLMPRGNVGTPLRVFLELIRACRLPPRIITQLQLQFPKTGSSRRYGNVPFEYE
DSETVEQEELVYTAEGEEIPQGTYLADIPASPCGEPEEEVGKEEEEESHSDEDDDRGEEW
ERHEALHEDVTGQERTTEQLFEEEIELKWEKGGSGLVFYTDAQFWQEEEGDFDEQTADDW
DVDMSVYYDRDGGDKDARDSVQMRLEQRLRDGQEDGSVIERQVGTFERHTKGIGRKVMER
QGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKLQPFGQLKRPRRNGLGLISTI
YDEPLPQDQTESLLRRQPPTSMKFRTDMAFVRGSSCASDSPSLPD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96I76	1.000	1.000	7.193E-100	525	1.000	1.000	Q96I76.pdb.gz	GPTC3_HUMAN G patch domain-containing protein 3 OS=Homo sapiens OX=9606 GN=GPATCH3 PE=1 SV=1
2	AFDB:A1L2F7	0.373	0.297	1.105E-43	669	0.550	0.432	A1L2F7.pdb.gz	A1L2F7_DANRE G patch domain-containing protein 3 OS=Danio rerio OX=7955 GN=gpatch3 PE=2 SV=1
3	AFDB:Q9FVW4	0.129	0.140	5.572E-2	482	0.084	0.091	Q9FVW4.pdb.gz	RENT3_ARATH Regulator of nonsense transcripts UPF3 OS=Arabidopsis thaliana OX=3702 GN=UPF3 PE=1 SV=1
4	PDB:6qw6R	0.119	0.470	1.491E-1	106	0.029	0.142	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
5	PDB:5etlD	0.137	0.349	1.903E-1	160	0.050	0.163	5etlD.pdb.gz	Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
6	PDB:2b3tB	0.119	0.185	2.428E-1	300	0.044	0.077	2b3tB.pdb.gz	Molecular basis for bacterial class I release factor methylation by PrmC
7	PDB:7oqcF	0.104	0.188	6.440E-1	267	0.032	0.064	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
8	AFDB:O95628	0.104	0.097	6.786E-1	575	0.131	0.120	O95628.pdb.gz	CNOT4_HUMAN CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3
9	PDB:5lsbA	0.114	0.304	1.115	176	0.023	0.068	5lsbA.pdb.gz
10	PDB:6cvlD	0.108	0.157	1.115	344	0.027	0.041	6cvlD.pdb.gz	Noncanonical role for the binding protein in substrate uptake by the MetNI methionine ATP Binding Cassette (ABC) transporter.
11	AFDB:Q9NW75	0.082	0.082	1.248	528	0.118	0.117	Q9NW75.pdb.gz	GPTC2_HUMAN G patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GPATCH2 PE=1 SV=1
12	PDB:4c3hG	0.081	0.134	1.339	259	0.055	0.112	4c3hG.pdb.gz	Crystal Structure of the 14-Subunit RNA Polymerase I
13	PDB:6g90B	0.109	0.268	1.423	193	0.034	0.093	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
14	PDB:6lurD	0.112	0.228	1.423	213	0.029	0.070	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.
15	PDB:7dvqI	0.109	0.375	1.423	128	0.036	0.148	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.
16	AFDB:Q9W0B0	0.050	0.026	2.033	1107	0.135	0.064	Q9W0B0.pdb.gz	Q9W0B0_DROME Serine-arginine repetitive matrix 2/3/4, isoform C OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=1 SV=2
17	AFDB:Q14028	0.053	0.028	3.311	1251	0.175	0.074	Q14028.pdb.gz	CNGB1_HUMAN Cyclic nucleotide-gated cation channel beta-1 OS=Homo sapiens OX=9606 GN=CNGB1 PE=1 SV=2
18	AFDB:A1Z8R2	0.074	0.040	3.976	1199	0.128	0.056	A1Z8R2.pdb.gz	A1Z8R2_DROME ADD domain-containing protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ADD1 PE=1 SV=1
19	AFDB:J9VI89	0.119	0.122	3.976	511	0.124	0.127	J9VI89.pdb.gz	TIF3_CRYNH Probable eukaryotic translation initiation factor 4H OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=TIF3 PE=1 SV=2
20	AFDB:Q69Z38	0.061	0.023	4.226	1735	0.137	0.041	Q69Z38.pdb.gz	PEAK1_MOUSE Inactive tyrosine-protein kinase PEAK1 OS=Mus musculus OX=10090 GN=Peak1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96I76	0.0	1072	525	1.000	1.000	GPTC3_HUMAN G patch domain-containing protein 3 OS=Homo sapiens OX=9606 GN=GPATCH3 PE=1 SV=1
2	A1L2F7	7.65e-97	309	669	0.303	0.238	A1L2F7_DANRE G patch domain-containing protein 3 OS=Danio rerio OX=7955 GN=gpatch3 PE=2 SV=1
3	Q5JYG5	1.96e-86	264	128	0.244	1.000	Q5JYG5_HUMAN G-patch domain containing 3 (Fragment) OS=Homo sapiens OX=9606 GN=GPATCH3 PE=1 SV=1
4	Q9ERA6	0.001	44.3	838	0.036	0.023	TFP11_MOUSE Tuftelin-interacting protein 11 OS=Mus musculus OX=10090 GN=Tfip11 PE=1 SV=1
5	Q9UBB9	0.001	44.3	837	0.036	0.023	TFP11_HUMAN Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1
6	Q9Y103	0.002	43.1	839	0.044	0.027	TFP11_DROME Septin-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=sip1 PE=1 SV=1
7	Q9SHG6	0.042	39.3	849	0.044	0.027	STIP1_ARATH Septin and tuftelin-interacting protein 1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=STIPL1 PE=1 SV=1
8	Q9UTK6	0.067	38.5	797	0.034	0.023	YKR3_SCHPO G-patch domain-containing protein C1486.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1486.03c PE=3 SV=1
9	Q9VPY4	0.076	38.5	1004	0.032	0.017	Q9VPY4_DROME FI21118p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4887 PE=1 SV=1
10	Q8SZM4	0.077	38.5	1004	0.032	0.017	Q8SZM4_DROME RH03791p OS=Drosophila melanogaster OX=7227 GN=CG4887 PE=2 SV=1
11	Q12019	0.086	38.5	4910	0.070	0.008	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
12	P87143	0.17	37.0	565	0.042	0.039	YDMD_SCHPO Uncharacterized RNA-binding protein C57A7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC57A7.13 PE=4 SV=1
13	Q9LRR5	0.20	37.0	1424	0.067	0.025	DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana OX=3702 GN=At3g14460 PE=3 SV=1
14	P52756	0.90	34.7	815	0.034	0.022	RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2
15	H7C1M2	1.1	34.7	1454	0.038	0.014	H7C1M2_HUMAN SON DNA and RNA binding protein (Fragment) OS=Homo sapiens OX=9606 GN=SON PE=1 SV=1
16	P18583	1.1	34.7	2426	0.038	0.008	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
17	Q9QX47	1.2	34.7	2444	0.038	0.008	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
18	Q6ZRV7	1.8	33.5	454	0.038	0.044	Q6ZRV7_HUMAN cDNA FLJ46057 fis, clone T1ESE2000609, highly similar to SON protein OS=Homo sapiens OX=9606 PE=1 SV=1
19	Q5QGN4	3.0	32.7	355	0.063	0.093	Q5QGN4_DANRE Hepatocellular carcinoma-related putative tumor suppressor LPTS OS=Danio rerio OX=7955 GN=cb342 PE=2 SV=2
20	Q06411	3.5	32.7	708	0.036	0.027	SP382_YEAST Pre-mRNA-splicing factor SPP382 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPP382 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01585 G-patch	0.00021	32.4	G-patch domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354645

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272647	0.643	AMMECR1-like protein
2	9606.ENSP00000360642	0.640	Coiled-coil and C2 domain-containing protein 1B
3	9606.ENSP00000466971	0.624	Transmembrane and ubiquitin like domain containing 2
4	9606.ENSP00000377725	0.592	Zinc finger protein with KRAB and SCAN domains 5
5	9606.ENSP00000405674	0.592	Nucleolar protein 7
6	9606.ENSP00000272418	0.583	Belongs to the universal ribosomal protein uS5 family.
7	9606.ENSP00000344393	0.577	rRNA-processing protein FCF1 homolog
8	9606.ENSP00000443176	0.577	Ring finger and SPRY domain containing 1
9	9606.ENSP00000257181	0.576	Pre-mRNA-splicing factor 38A
10	9606.ENSP00000350869	0.575	Zinc finger protein 346
11	9606.ENSP00000359050	0.551	UPF0668 protein C10orf76
12	9606.ENSP00000251038	0.544	Zinc finger CCCH domain-containing protein 14
13	9606.ENSP00000485378	0.542	Ribonuclease P protein subunit p21
14	9606.ENSP00000399862	0.541	CCR4-NOT transcription complex subunit 10
15	9606.ENSP00000380054	0.535	ELL-associated factor 1
16	9606.ENSP00000283027	0.528	Cytosolic Fe-S cluster assembly factor NUBP1
17	9606.ENSP00000479964	0.525	Kanadaptin
18	9606.ENSP00000262103	0.523	EF-hand calcium-binding domain-containing protein 1
19	9606.ENSP00000365625	0.523	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
20	9606.ENSP00000362687	0.520	ATP-dependent RNA helicase DDX50

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.315	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0050794	0.977	regulation of cellular process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0048519	0.966	negative regulation of biological process
GO:0051171	0.958	regulation of nitrogen compound metabolic process
GO:0080090	0.957	regulation of primary metabolic process
GO:0048518	0.943	positive regulation of biological process
GO:0010468	0.903	regulation of gene expression
GO:0048583	0.892	regulation of response to stimulus
GO:0062207	0.856	regulation of pattern recognition receptor signaling pathway
GO:0032479	0.841	regulation of type I interferon production
GO:0019219	0.821	regulation of nucleobase-containing compound metabolic process
GO:0010605	0.811	negative regulation of macromolecule metabolic process
GO:0048585	0.800	negative regulation of response to stimulus
GO:0051252	0.794	regulation of RNA metabolic process
GO:0048523	0.743	negative regulation of cellular process
GO:0048522	0.743	positive regulation of cellular process
GO:0009889	0.738	regulation of biosynthetic process
GO:0002832	0.727	negative regulation of response to biotic stimulus
GO:0031348	0.722	negative regulation of defense response
GO:0032102	0.719	negative regulation of response to external stimulus
GO:0009987	0.717	cellular process
GO:0001818	0.711	negative regulation of cytokine production
GO:0050688	0.707	regulation of defense response to virus
GO:0009893	0.701	positive regulation of metabolic process
GO:0050687	0.701	negative regulation of defense response to virus
GO:0002683	0.690	negative regulation of immune system process
GO:0039531	0.684	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0032480	0.650	negative regulation of type I interferon production
GO:0031326	0.646	regulation of cellular biosynthetic process
GO:0010604	0.558	positive regulation of macromolecule metabolic process
GO:0031325	0.547	positive regulation of cellular metabolic process
GO:0006355	0.513	regulation of DNA-templated transcription
GO:0008152	0.499	metabolic process
GO:0044238	0.494	primary metabolic process
GO:0071704	0.492	organic substance metabolic process
GO:0051173	0.480	positive regulation of nitrogen compound metabolic process
GO:0044237	0.478	cellular metabolic process
GO:0051254	0.446	positive regulation of RNA metabolic process
GO:0043170	0.396	macromolecule metabolic process
GO:0006807	0.355	nitrogen compound metabolic process
GO:0023057	0.341	negative regulation of signaling
GO:0010648	0.341	negative regulation of cell communication
GO:0009968	0.325	negative regulation of signal transduction
GO:0010557	0.316	positive regulation of macromolecule biosynthetic process
GO:0031328	0.316	positive regulation of cellular biosynthetic process
GO:1903508	0.310	positive regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]