StarFunc result for job id Q96I99

User Input

>input (432 residues)
MASPVAAQAGKLLRALALRPRFLAAGSQAVQLTSRRWLNLQEYQSKKLMSDNGVRVQRFF
VADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQM
IGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEV
AASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQV
EVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLD
GNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILV
NIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLED
AAKKAVASVAKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1H270	0.957	0.953	2.645E-84	434	0.903	0.899	B1H270.pdb.gz	B1H270_RAT Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Suclg2 PE=2 SV=1
2	PDB:1eudB	0.890	0.972	2.967E-76	395	0.877	0.959	1eudB.pdb.gz
3	PDB:7jmkD	0.796	0.966	4.724E-63	354	0.782	0.955	7jmkD.pdb.gz	Second distinct conformation of the phosphohistidine loop in succinyl-CoA synthetase
4	AFDB:F1LM47	0.901	0.838	3.026E-61	465	0.519	0.482	F1LM47.pdb.gz	F1LM47_RAT Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sucla2 PE=1 SV=1
5	AFDB:E5KS60	0.894	0.835	1.115E-60	463	0.502	0.469	E5KS60.pdb.gz	E5KS60_HUMAN Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2 PE=1 SV=1
6	AFDB:A0A2R8Y6Y7	0.904	0.808	1.900E-60	484	0.493	0.440	A0A2R8Y6Y7.pdb.gz	A0A2R8Y6Y7_HUMAN Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2 PE=1 SV=1
7	AFDB:Q95U38	0.897	0.773	1.193E-59	503	0.481	0.414	Q95U38.pdb.gz	Q95U38_DROME Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ScsbetaA PE=1 SV=1
8	AFDB:P53588	0.900	0.894	1.007E-58	435	0.468	0.464	P53588.pdb.gz	SUCB1_CAEEL Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=suca-1 PE=3 SV=1
9	AFDB:O82662	0.870	0.892	1.365E-57	421	0.463	0.475	O82662.pdb.gz	SUCB_ARATH Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g20420 PE=1 SV=1
10	AFDB:Q84LB6	0.892	0.924	1.365E-57	417	0.444	0.460	Q84LB6.pdb.gz	SUCB_SOLLC Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Solanum lycopersicum OX=4081 PE=1 SV=1
11	AFDB:O94415	0.901	0.899	1.550E-56	433	0.458	0.457	O94415.pdb.gz	SUCB_SCHPO Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1620.08 PE=3 SV=1
12	AFDB:P53312	0.874	0.884	5.381E-56	427	0.444	0.450	P53312.pdb.gz	SUCB_YEAST Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSC2 PE=1 SV=1
13	PDB:1jkjB	0.860	0.955	7.522E-50	388	0.396	0.441	1jkjB.pdb.gz	Two glutamate residues, Glu 208 alpha and Glu 197 beta, are crucial for phosphorylation and dephosphorylation of the active-site histidine residue in succinyl-CoA synthetase.
14	PDB:6qfbB	0.717	0.323	2.768E-21	1035	0.208	0.087	6qfbB.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.
15	PDB:6qfbC	0.710	0.328	8.042E-21	1011	0.204	0.087	6qfbC.pdb.gz	Structure of ATP citrate lyase and the origin of citrate synthase in the Krebs cycle.
16	PDB:1bxrA	0.201	0.089	3.141E-6	1073	0.118	0.048	1bxrA.pdb.gz	Carbamoyl phosphate synthetase: closure of the B-domain as a result of nucleotide binding.
17	PDB:4c5aA	0.275	0.373	8.107E-6	306	0.074	0.105	4c5aA.pdb.gz	Inhibition of D-Ala:D-Ala ligase through a phosphorylated form of the antibiotic D-cycloserine.
18	PDB:5douD	0.158	0.057	1.556E-5	1430	0.102	0.031	5douD.pdb.gz	Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis.
19	PDB:3lwbB	0.282	0.389	1.858E-5	298	0.081	0.117	3lwbB.pdb.gz
20	PDB:3vpbB	0.275	0.401	1.972E-5	282	0.067	0.103	3vpbB.pdb.gz	Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZV34	0.0	729	401	0.829	0.893	A0A8I5ZV34_RAT Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Suclg2 PE=1 SV=1
2	A0A8I6AHY6	0.0	728	424	0.829	0.844	A0A8I6AHY6_RAT Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Suclg2 PE=1 SV=1
3	A0A8I6AIH6	0.0	729	438	0.826	0.815	A0A8I6AIH6_RAT Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Suclg2 PE=1 SV=1
4	B1H270	0.0	772	434	0.877	0.873	B1H270_RAT Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Suclg2 PE=2 SV=1
5	F1LPV8	0.0	748	425	0.859	0.873	F1LPV8_RAT Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Suclg2 PE=1 SV=3
6	P53590	0.0	823	433	0.944	0.942	SUCB2_PIG Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial (Fragment) OS=Sus scrofa OX=9823 GN=SUCLG2 PE=1 SV=2
7	Q499V7	0.0	780	429	0.887	0.893	Q499V7_RAT Succinate-CoA ligase subunit beta (Fragment) OS=Rattus norvegicus OX=10116 GN=Suclg2 PE=2 SV=1
8	Q5EBA9	0.0	716	387	0.815	0.910	Q5EBA9_RAT Succinate-CoA ligase subunit beta (Fragment) OS=Rattus norvegicus OX=10116 GN=Suclg2 PE=2 SV=1
9	Q68FT4	0.0	781	432	0.889	0.889	Q68FT4_RAT Succinate-CoA ligase subunit beta (Fragment) OS=Rattus norvegicus OX=10116 GN=Suclg2 PE=2 SV=1
10	Q96I99	0.0	870	432	1.000	1.000	SUCB2_HUMAN Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG2 PE=1 SV=2
11	Q9Z2I8	0.0	784	433	0.903	0.901	SUCB2_MOUSE Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Suclg2 PE=1 SV=3
12	B2RZ24	8.01e-147	426	438	0.495	0.489	B2RZ24_RAT Succinate-CoA ligase subunit beta (Fragment) OS=Rattus norvegicus OX=10116 GN=Sucla2 PE=2 SV=1
13	F1LM47	9.63e-147	427	465	0.495	0.460	F1LM47_RAT Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sucla2 PE=1 SV=1
14	A0A8I6A1U8	1.80e-146	426	458	0.493	0.465	A0A8I6A1U8_RAT Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sucla2 PE=1 SV=1
15	Q9Z2I9	2.40e-146	426	463	0.498	0.464	SUCB1_MOUSE Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Sucla2 PE=1 SV=2
16	E5KS60	9.33e-142	414	463	0.486	0.454	E5KS60_HUMAN Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2 PE=1 SV=1
17	Q9P2R7	9.33e-142	414	463	0.486	0.454	SUCB1_HUMAN Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2 PE=1 SV=3
18	A0A2R8YDQ9	5.67e-138	403	405	0.475	0.506	A0A2R8YDQ9_HUMAN Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2 PE=1 SV=1
19	A0A2R8Y6Y7	1.96e-136	402	484	0.484	0.432	A0A2R8Y6Y7_HUMAN Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2 PE=1 SV=1
20	O82662	1.34e-133	392	421	0.479	0.492	SUCB_ARATH Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g20420 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02222 ATP-grasp	1.6e+02	13.3	ATP-grasp domain
2	PF08442 ATP-grasp_2	1.7e-74	261.3	ATP-grasp domain
3	PF13549 ATP-grasp_5	4.6e-05	34.5	ATP-grasp domain
4	PF11339 DUF3141	4e+02	11.0	Protein of unknown function (DUF3141)
5	PF01071 GARS_A	4.7	18.5	Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
6	PF00549 Ligase_CoA	2.6e-23	94.0	CoA-ligase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009188

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009905	0.999	annotation not available
2	61853.ENSNLEP00000001540	0.998	Uncharacterized protein
3	61853.ENSNLEP00000016091	0.992	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
4	61853.ENSNLEP00000017490	0.991	Succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
5	61853.ENSNLEP00000019834	0.991	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
6	61853.ENSNLEP00000001513	0.977	annotation not available
7	61853.ENSNLEP00000013082	0.977	Uncharacterized protein
8	61853.ENSNLEP00000003577	0.969	succinate-CoA ligase, ADP-forming, beta subunit
9	61853.ENSNLEP00000022497	0.969	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit
10	61853.ENSNLEP00000005072	0.966	Methylmalonyl CoA mutase
11	61853.ENSNLEP00000008892	0.929	Acetyltransferase component of pyruvate dehydrogenase complex
12	61853.ENSNLEP00000010539	0.887	Dihydrolipoamide dehydrogenase
13	61853.ENSNLEP00000008812	0.876	acetyl-CoA acetyltransferase 1
14	61853.ENSNLEP00000004855	0.874	Oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide)
15	61853.ENSNLEP00000002477	0.869	Uncharacterized protein
16	61853.ENSNLEP00000013566	0.860	acetyl-CoA acetyltransferase 2
17	61853.ENSNLEP00000014103	0.860	acetyl-CoA acyltransferase 2
18	61853.ENSNLEP00000003141	0.844	acetyl-CoA carboxylase alpha
19	61853.ENSNLEP00000010667	0.836	3-hydroxymethyl-3-methylglutaryl-CoA lyase
20	61853.ENSNLEP00000012364	0.831	acyl-CoA synthetase short-chain family member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0043168	1.000	anion binding
GO:0004774	1.000	succinate-CoA ligase activity
GO:0032555	1.000	purine ribonucleotide binding
GO:0019003	0.993	GDP binding
GO:0005515	0.912	protein binding
GO:0004776	0.381	succinate-CoA ligase (GDP-forming) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006753	0.995	nucleoside phosphate metabolic process
GO:0043648	0.993	dicarboxylic acid metabolic process
GO:0006637	0.989	acyl-CoA metabolic process
GO:0006099	0.987	tricarboxylic acid cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	1.000	catalytic complex
GO:0005759	1.000	mitochondrial matrix
GO:0098798	0.977	mitochondrial protein-containing complex
GO:0030062	0.956	mitochondrial tricarboxylic acid cycle enzyme complex
GO:0016020	0.934	membrane
GO:0071944	0.591	cell periphery
GO:0005886	0.541	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
RHEA:22120	0.381	CoA + GTP + succinate = GDP + phosphate + succinyl-CoA
EC:6.2.1.4	0.381	succinate--CoA ligase (GDP-forming).

[back to server]