StarFunc result for job id Q96IF1

User Input

>input (538 residues)
MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEP
LEPAREQGSLDAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSP
RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAG
PCLFGPPLAGAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGA
LAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTGGREAGARGE
PSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSNACQALDSLYH
TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV
RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UGP4	0.364	0.291	1.215E-32	676	0.377	0.300	Q9UGP4.pdb.gz	LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
2	AFDB:Q9N675	0.294	0.272	2.944E-28	585	0.243	0.224	Q9N675.pdb.gz	Q9N675_DROME Zyx102 protein OS=Drosophila melanogaster OX=7227 GN=Zyx PE=1 SV=1
3	AFDB:A0A1B0GTU4	0.265	0.142	6.635E-14	1081	0.210	0.105	A0A1B0GTU4.pdb.gz	A0A1B0GTU4_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=1
4	AFDB:A0A1D8PRQ6	0.177	0.079	4.193E-12	1468	0.186	0.068	A0A1D8PRQ6.pdb.gz	A0A1D8PRQ6_CANAL Lrg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LRG1 PE=4 SV=1
5	AFDB:Q54Z52	0.107	0.073	3.727E-9	822	0.106	0.069	Q54Z52.pdb.gz	Q54Z52_DICDI Prespore-specific protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277777 PE=4 SV=1
6	PDB:4kfzB	0.135	0.405	3.580E-7	148	0.048	0.176	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
7	AFDB:Q9UBW7	0.087	0.048	8.665E-6	1377	0.160	0.062	Q9UBW7.pdb.gz	ZMYM2_HUMAN Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1
8	PDB:1b8tA	0.119	0.310	9.754E-6	192	0.082	0.229	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
9	AFDB:Q14202	0.098	0.048	2.407E-5	1370	0.190	0.074	Q14202.pdb.gz	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
10	PDB:1imlA	0.104	0.576	1.103E-2	76	0.041	0.289	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
11	AFDB:O88491	0.094	0.026	3.674E-2	2588	0.188	0.039	O88491.pdb.gz	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
12	AFDB:Q9VI93	0.061	0.048	1.861E-1	946	0.191	0.109	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
13	AFDB:Q92908	0.058	0.052	4.065E-1	595	0.164	0.148	Q92908.pdb.gz	GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens OX=9606 GN=GATA6 PE=1 SV=2
14	PDB:7uhyA	0.047	0.037	5.159E-1	771	0.028	0.019	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7uhyC	0.086	0.081	6.968E-1	578	0.026	0.024	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:7c4cA	0.055	0.077	7.857E-1	332	0.030	0.048	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
17	PDB:7q3nU	0.074	0.112	9.409E-1	292	0.054	0.099	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
18	PDB:5a31B	0.054	0.231	9.992E-1	84	0.022	0.143	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
19	PDB:7uhyD	0.078	0.134	1.061	288	0.019	0.035	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:5gm6a	0.055	0.199	1.349	123	0.030	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5U2Z2	0.0	939	548	0.931	0.914	AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus OX=10116 GN=Ajuba PE=1 SV=1
2	Q91XC0	0.0	938	547	0.935	0.920	AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus OX=10090 GN=Ajuba PE=1 SV=1
3	Q96IF1	0.0	1074	538	1.000	1.000	AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1
4	E7FFI0	2.84e-129	394	688	0.457	0.358	E7FFI0_DANRE Ajuba LIM protein OS=Danio rerio OX=7955 GN=ajuba PE=4 SV=1
5	A9LS46	6.33e-109	342	690	0.264	0.206	WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis OX=8355 GN=wtip PE=1 SV=1
6	A8DZE6	1.15e-102	324	648	0.258	0.215	WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio OX=7955 GN=wtip PE=3 SV=1
7	Q7TQJ8	3.75e-102	315	398	0.258	0.349	WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus OX=10090 GN=Wtip PE=1 SV=1
8	A6NIX2	4.57e-100	310	430	0.257	0.321	WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens OX=9606 GN=WTIP PE=1 SV=3
9	Q9UGP4	4.67e-99	315	676	0.251	0.200	LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
10	Q9QXD8	9.78e-99	315	668	0.253	0.204	LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Limd1 PE=1 SV=2
11	Q06BR1	2.95e-95	304	612	0.232	0.204	LIMD1_XENLA LIM domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=limd1 PE=1 SV=1
12	Q9VY77	7.18e-95	306	728	0.240	0.177	AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster OX=7227 GN=jub PE=1 SV=3
13	C9JRJ5	6.54e-68	232	620	0.188	0.163	C9JRJ5_HUMAN LIM domain containing 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
14	Q7ZU85	1.98e-67	229	556	0.173	0.167	Q7ZU85_DANRE LIM domain containing preferred translocation partner in lipoma OS=Danio rerio OX=7955 GN=zgc:56152 PE=1 SV=1
15	Q8T0F5	1.04e-66	228	564	0.191	0.183	Q8T0F5_DROME LD06023 isoform OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1
16	Q9N675	1.63e-66	228	585	0.191	0.176	Q9N675_DROME Zyx102 protein OS=Drosophila melanogaster OX=7227 GN=Zyx PE=1 SV=1
17	H9XVP5	1.87e-66	225	496	0.191	0.208	H9XVP5_DROME Zyxin, isoform H OS=Drosophila melanogaster OX=7227 GN=Zyx PE=4 SV=1
18	Q8I0G8	1.87e-66	226	523	0.191	0.197	Q8I0G8_DROME FI16750p1 OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1
19	Q5U0W6	2.61e-65	223	525	0.188	0.192	Q5U0W6_DROME HL05789p OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1
20	Q93052	1.35e-63	220	612	0.197	0.173	LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00412 LIM	3.7e-24	96.0	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262713

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216911	0.955	Aurora kinase A
2	9606.ENSP00000372035	0.954	Serine/threonine-protein kinase LATS2
3	9606.ENSP00000437550	0.945	Serine/threonine-protein kinase LATS1
4	9606.ENSP00000261769	0.944	Cadherin-1
5	9606.ENSP00000304669	0.940	Catenin alpha-1
6	9606.ENSP00000324729	0.932	Protein salvador homolog 1
7	9606.ENSP00000344456	0.913	Catenin beta-1
8	9606.ENSP00000382004	0.911	Catenin delta-1
9	9606.ENSP00000377508	0.901	Junction plakoglobin
10	9606.ENSP00000349722	0.900	Ubiquitin conjugating enzyme E2 D3
11	9606.ENSP00000363019	0.900	Ubiquitin-conjugating enzyme E2 D1
12	9606.ENSP00000381717	0.900	Ubiquitin-conjugating enzyme E2 D2
13	9606.ENSP00000268712	0.881	Nuclear receptor corepressor 1
14	9606.ENSP00000355133	0.843	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
15	9606.ENSP00000273317	0.822	LIM domain-containing protein 1
16	9606.ENSP00000466953	0.817	Wilms tumor protein 1-interacting protein
17	9606.ENSP00000388510	0.810	Retinoic acid receptor gamma
18	9606.ENSP00000302967	0.800	Histone deacetylase 3
19	9606.ENSP00000254066	0.764	Retinoic acid receptor alpha
20	9606.ENSP00000427772	0.751	Protein KIBRA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003714	0.998	transcription corepressor activity
GO:0045294	0.992	alpha-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0050896	0.988	response to stimulus
GO:0009987	0.963	cellular process
GO:0048519	0.954	negative regulation of biological process
GO:0010468	0.945	regulation of gene expression
GO:0048518	0.916	positive regulation of biological process
GO:0010605	0.870	negative regulation of macromolecule metabolic process
GO:0048523	0.867	negative regulation of cellular process
GO:0009966	0.856	regulation of signal transduction
GO:1902531	0.816	regulation of intracellular signal transduction
GO:0051171	0.748	regulation of nitrogen compound metabolic process
GO:0031323	0.747	regulation of cellular metabolic process
GO:0080090	0.745	regulation of primary metabolic process
GO:0048522	0.735	positive regulation of cellular process
GO:0009968	0.711	negative regulation of signal transduction
GO:1902532	0.569	negative regulation of intracellular signal transduction
GO:0008152	0.533	metabolic process
GO:0071840	0.529	cellular component organization or biogenesis
GO:0035331	0.511	negative regulation of hippo signaling
GO:0006950	0.503	response to stress
GO:0071704	0.489	organic substance metabolic process
GO:0044237	0.483	cellular metabolic process
GO:0044238	0.482	primary metabolic process
GO:0016043	0.480	cellular component organization
GO:0051716	0.470	cellular response to stimulus
GO:0060964	0.461	regulation of miRNA-mediated gene silencing
GO:0010629	0.460	negative regulation of gene expression
GO:0010556	0.446	regulation of macromolecule biosynthetic process
GO:0031326	0.445	regulation of cellular biosynthetic process
GO:0035195	0.437	miRNA-mediated gene silencing
GO:0009893	0.418	positive regulation of metabolic process
GO:0051252	0.417	regulation of RNA metabolic process
GO:0010604	0.409	positive regulation of macromolecule metabolic process
GO:0051172	0.398	negative regulation of nitrogen compound metabolic process
GO:0032502	0.376	developmental process
GO:0051173	0.368	positive regulation of nitrogen compound metabolic process
GO:0031324	0.361	negative regulation of cellular metabolic process
GO:0031325	0.359	positive regulation of cellular metabolic process
GO:0048856	0.356	anatomical structure development
GO:0006355	0.346	regulation of DNA-templated transcription
GO:0051246	0.300	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.992	cytosol
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0030054	0.980	cell junction
GO:0070161	0.971	anchoring junction
GO:0005911	0.741	cell-cell junction
GO:0032991	0.695	protein-containing complex
GO:0012505	0.323	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]