StarFunc result for job id Q96IG2

User Input

>input (436 residues)
MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLAL
DGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIE
VLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCD
QVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLI
TICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE
LEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIE
LDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPP
SVGGSRQRFCRCCIIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96IG2	1.000	1.000	1.480E-85	436	1.000	1.000	Q96IG2.pdb.gz	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
2	AFDB:Q8BH16	0.921	0.948	1.967E-66	423	0.745	0.768	Q8BH16.pdb.gz	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
3	PDB:6o60C	0.849	0.948	4.026E-59	389	0.702	0.787	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
4	AFDB:A8DYA6	0.922	0.623	3.751E-56	651	0.564	0.378	A8DYA6.pdb.gz	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
5	AFDB:P34284	0.924	0.866	3.710E-52	466	0.472	0.442	P34284.pdb.gz	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
6	AFDB:Q5BJ29	0.707	0.633	5.788E-30	491	0.255	0.226	Q5BJ29.pdb.gz	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
7	AFDB:C8V4D4	0.772	0.585	1.070E-28	585	0.252	0.188	C8V4D4.pdb.gz	GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=grrA PE=2 SV=1
8	AFDB:Q8CDU4	0.374	0.257	3.887E-28	790	0.255	0.141	Q8CDU4.pdb.gz	FXL13_MOUSE F-box and leucine-rich repeat protein 13 OS=Mus musculus OX=10090 GN=Fbxl13 PE=1 SV=2
9	AFDB:Q8NEE6	0.551	0.347	5.442E-28	735	0.268	0.159	Q8NEE6.pdb.gz	FXL13_HUMAN F-box and leucine-rich repeat protein 13 OS=Homo sapiens OX=9606 GN=FBXL13 PE=2 SV=3
10	AFDB:Q6TGX5	0.771	0.815	1.412E-27	411	0.273	0.290	Q6TGX5.pdb.gz	Q6TGX5_DANRE F-box and leucine-rich repeat protein 14a OS=Danio rerio OX=7955 GN=wu:fi25d04 PE=2 SV=1
11	AFDB:B1H1X1	0.759	0.503	5.427E-27	673	0.204	0.132	B1H1X1.pdb.gz	FXL17_XENLA F-box/LRR-repeat protein 17 OS=Xenopus laevis OX=8355 GN=fbxl17 PE=2 SV=1
12	PDB:2p1nB	0.447	0.359	7.848E-16	571	0.206	0.158	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
13	PDB:3oglB	0.413	0.342	9.286E-16	568	0.186	0.143	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
14	PDB:7sa1B	0.504	0.376	1.375E-15	624	0.222	0.155	7sa1B.pdb.gz
15	PDB:1a4yA	0.537	0.514	6.614E-15	460	0.220	0.209	1a4yA.pdb.gz
16	PDB:7b5mT	0.429	0.561	5.270E-14	325	0.172	0.231	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
17	PDB:4i6jB	0.558	0.608	5.880E-13	394	0.170	0.188	4i6jB.pdb.gz
18	PDB:7pmkL	0.625	0.579	8.233E-13	475	0.177	0.162	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
19	PDB:5hywA	0.442	0.350	1.443E-12	580	0.195	0.147	5hywA.pdb.gz
20	PDB:7pzcA	0.522	0.255	1.707E-12	1010	0.174	0.075	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BH16	0.0	691	423	0.745	0.768	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
2	Q96IG2	0.0	884	436	1.000	1.000	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
3	Q9CZV8	0.0	882	436	0.998	0.998	FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus OX=10090 GN=Fbxl20 PE=1 SV=3
4	Q9UKC9	0.0	694	423	0.757	0.780	FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2 PE=1 SV=3
5	A8DYA5	6.78e-176	500	426	0.562	0.575	A8DYA5_DROME LP16447p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
6	Q5BI22	7.34e-176	500	437	0.562	0.561	Q5BI22_DROME LD12638p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
7	A0A0B4KEK4	9.59e-176	501	455	0.562	0.538	A0A0B4KEK4_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
8	A1Z8M8	1.04e-175	501	464	0.562	0.528	A1Z8M8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
9	A0A0B4KEU4	4.40e-175	501	497	0.562	0.493	A0A0B4KEU4_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
10	A8DYA6	2.34e-173	502	651	0.562	0.376	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
11	P34284	9.20e-148	430	466	0.470	0.440	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
12	Q5BJ29	1.39e-43	161	491	0.241	0.214	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
13	Q9UJT9	2.56e-43	160	491	0.239	0.212	FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606 GN=FBXL7 PE=1 SV=1
14	Q9VF10	1.47e-39	153	772	0.264	0.149	Q9VF10_DROME F-box and leucine-rich repeat protein 7 OS=Drosophila melanogaster OX=7227 GN=Fbxl7 PE=1 SV=2
15	Q8NEE6	2.99e-39	152	735	0.252	0.150	FXL13_HUMAN F-box and leucine-rich repeat protein 13 OS=Homo sapiens OX=9606 GN=FBXL13 PE=2 SV=3
16	C8V4D4	4.68e-38	147	585	0.321	0.239	GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=grrA PE=2 SV=1
17	Q8N1E6	1.26e-36	140	418	0.284	0.297	FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens OX=9606 GN=FBXL14 PE=1 SV=1
18	Q6TGX5	8.18e-36	138	411	0.275	0.292	Q6TGX5_DANRE F-box and leucine-rich repeat protein 14a OS=Danio rerio OX=7955 GN=wu:fi25d04 PE=2 SV=1
19	Q5RH13	1.14e-35	137	400	0.282	0.307	Q5RH13_DANRE F-box and leucine-rich repeat protein 14b OS=Danio rerio OX=7955 GN=fbxl14 PE=2 SV=1
20	Q9C5D2	9.74e-35	138	610	0.220	0.157	FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana OX=3702 GN=FBL4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	0.00071	30.6	F-box domain
2	PF12937 F-box-like	1.3e-09	49.1	F-box-like
3	PF15966 F-box_4	6.3	18.1	F-box
4	PF00560 LRR_1	0.044	25.1	Leucine Rich Repeat
5	PF12799 LRR_4	1.6e-15	68.2	Leucine Rich repeats (2 copies)
6	PF13516 LRR_6	3.3e-14	62.7	Leucine Rich repeat
7	PF13855 LRR_8	0.016	26.3	Leucine rich repeat
8	PF03337 Pox_F12L	9.6e+02	9.3	Poxvirus F12L protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006832610.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006872968.1	0.960	S-phase kinase-associated protein 1
2	185453.XP_006861264.1	0.893	Cullin-1
3	185453.XP_006834974.1	0.734	Protein prenyltransferase alpha subunit repeat-containing protein 1
4	185453.XP_006878436.1	0.714	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 1 base in 1 codon
5	185453.XP_006831461.1	0.713	CDK2-associated and cullin domain-containing protein 1
6	185453.XP_006861958.1	0.713	Cullin-3 isoform X1
7	185453.XP_006866940.1	0.697	E3 ubiquitin-protein ligase RBX1
8	185453.XP_006869872.1	0.625	Kelch-like protein 24
9	185453.XP_006869456.1	0.610	F-box/SPRY domain-containing protein 1
10	185453.XP_006866839.1	0.591	COP9 signalosome complex subunit 8-like
11	185453.XP_006869722.1	0.563	Septin-9
12	185453.XP_006864940.1	0.552	F-box only protein 3
13	185453.XP_006860347.1	0.542	Ubiquitin carboxyl-terminal hydrolase 10
14	185453.XP_006835586.1	0.539	NEDD8
15	185453.XP_006832090.1	0.535	F-box/LRR-repeat protein 3
16	185453.XP_006839495.1	0.535	F-box only protein 11
17	185453.XP_006871977.1	0.531	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 13 Proteins
18	185453.XP_006876391.1	0.518	Phosphatidylinositol 3-kinase regulatory subunit beta
19	185453.XP_006878412.1	0.514	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
20	185453.XP_006859592.1	0.500	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 20 Proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990756	0.458	ubiquitin ligase-substrate adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.953	regulation of cellular process
GO:0050896	0.855	response to stimulus
GO:0008152	0.739	metabolic process
GO:0071704	0.664	organic substance metabolic process
GO:0044238	0.651	primary metabolic process
GO:0006807	0.619	nitrogen compound metabolic process
GO:0010646	0.611	regulation of cell communication
GO:0023051	0.604	regulation of signaling
GO:0044237	0.563	cellular metabolic process
GO:0043170	0.492	macromolecule metabolic process
GO:0019222	0.475	regulation of metabolic process
GO:0006950	0.469	response to stress
GO:0019538	0.458	protein metabolic process
GO:0060255	0.439	regulation of macromolecule metabolic process
GO:0048518	0.413	positive regulation of biological process
GO:0070647	0.393	protein modification by small protein conjugation or removal
GO:0044265	0.385	cellular macromolecule catabolic process
GO:0032446	0.375	protein modification by small protein conjugation
GO:0006511	0.324	ubiquitin-dependent protein catabolic process
GO:0080090	0.314	regulation of primary metabolic process
GO:0051171	0.314	regulation of nitrogen compound metabolic process
GO:0016567	0.314	protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0016020	0.988	membrane
GO:0032991	0.976	protein-containing complex
GO:0005829	0.972	cytosol
GO:1902494	0.827	catalytic complex
GO:1990234	0.824	transferase complex
GO:0043231	0.791	intracellular membrane-bounded organelle
GO:0000151	0.538	ubiquitin ligase complex
GO:0031461	0.505	cullin-RING ubiquitin ligase complex
GO:0030054	0.444	cell junction
GO:0071944	0.370	cell periphery
GO:0019005	0.345	SCF ubiquitin ligase complex
GO:0005886	0.340	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]