StarFunc result for job id Q96IK1

User Input

>input (185 residues)
MADGGGGGGTGAVGGGGTSQASAGAATGATGASGGGGPINPASLPPGDPQLIALIVEQLK
SRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVV
QSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPAP
SQDTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96IK1	1.000	1.000	1.234E-25	185	1.000	1.000	Q96IK1.pdb.gz	BOD1_HUMAN Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2
2	AFDB:Q8IYS8	0.716	0.767	1.458E-18	172	0.800	0.860	Q8IYS8.pdb.gz	BD1L2_HUMAN Biorientation of chromosomes in cell division protein 1-like 2 OS=Homo sapiens OX=9606 GN=BOD1L2 PE=1 SV=2
3	AFDB:A0A0B4KHZ9	0.549	0.093	4.078E-9	1151	0.319	0.051	A0A0B4KHZ9.pdb.gz	A0A0B4KHZ9_DROME Biorientation defective 1, isoform E OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
4	AFDB:Q9QXV3	0.179	0.140	1.246E-1	279	0.168	0.111	Q9QXV3.pdb.gz	ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus OX=10090 GN=Ing1 PE=2 SV=1
5	AFDB:Q9ESK4	0.196	0.156	1.323E-1	281	0.141	0.093	Q9ESK4.pdb.gz	ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus OX=10090 GN=Ing2 PE=1 SV=3
6	AFDB:Q6PEY1	0.248	0.276	4.092E-1	159	0.157	0.182	Q6PEY1.pdb.gz	TMM88_HUMAN Transmembrane protein 88 OS=Homo sapiens OX=9606 GN=TMEM88 PE=1 SV=1
7	AFDB:Q9D0N8	0.243	0.269	7.867E-1	159	0.162	0.189	Q9D0N8.pdb.gz	TMM88_MOUSE Transmembrane protein 88 OS=Mus musculus OX=10090 GN=Tmem88 PE=1 SV=1
8	AFDB:Q96MC5	0.162	0.148	1.059	204	0.141	0.127	Q96MC5.pdb.gz	MERB1_HUMAN bMERB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BMERB1 PE=1 SV=1
9	AFDB:Q9M9U9	0.176	0.131	1.193	269	0.124	0.086	Q9M9U9.pdb.gz	RKD1_ARATH Protein RKD1 OS=Arabidopsis thaliana OX=3702 GN=RKD1 PE=3 SV=1
10	PDB:1kmiZ	0.217	0.225	1.590	177	0.108	0.113	1kmiZ.pdb.gz	Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
11	PDB:7vvuV	0.161	0.226	1.687	113	0.076	0.124	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
12	AFDB:A0A1D8PDP3	0.232	0.086	1.704	677	0.135	0.037	A0A1D8PDP3.pdb.gz	A0A1D8PDP3_CANAL Rgd1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RGD1 PE=4 SV=1
13	PDB:4ke2A	0.150	0.142	1.900	196	0.081	0.077	4ke2A.pdb.gz
14	PDB:1u2mC	0.261	0.324	2.140	143	0.059	0.077	1u2mC.pdb.gz
15	PDB:4wa6B	0.244	0.376	2.271	96	0.103	0.198	4wa6B.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
16	PDB:6so5C	0.251	0.293	3.057	144	0.097	0.125	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
17	PDB:7z1lA	0.223	0.035	3.443	1436	0.059	0.008	7z1lA.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
18	PDB:4kxrB	0.145	0.151	3.653	174	0.162	0.172	4kxrB.pdb.gz
19	PDB:2w4mA	0.194	0.149	3.877	250	0.108	0.080	2w4mA.pdb.gz
20	PDB:4n78F	0.147	0.163	4.366	156	0.114	0.135	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96IK1	4.87e-134	374	185	1.000	1.000	BOD1_HUMAN Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2
2	Q8IYS8	6.16e-96	277	172	0.741	0.797	BD1L2_HUMAN Biorientation of chromosomes in cell division protein 1-like 2 OS=Homo sapiens OX=9606 GN=BOD1L2 PE=1 SV=2
3	Q8NFC6	1.53e-59	202	3051	0.449	0.027	BD1L1_HUMAN Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2
4	Q9VAY4	8.75e-31	119	1109	0.286	0.048	Q9VAY4_DROME Biorientation defective 1, isoform A OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=2
5	A0A0B4KHZ9	1.19e-30	119	1151	0.286	0.046	A0A0B4KHZ9_DROME Biorientation defective 1, isoform E OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
6	Q8IMM6	1.28e-30	119	1150	0.286	0.046	Q8IMM6_DROME Biorientation defective 1, isoform B OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05205 COMPASS-Shg1	4.1e-21	86.9	COMPASS (Complex proteins associated with Set1p) component shg1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309644

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319417	0.934	Spindle and kinetochore-associated protein 3
2	9606.ENSP00000285116	0.925	Spindle and kinetochore-associated protein 1
3	9606.ENSP00000287598	0.918	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
4	9606.ENSP00000333433	0.910	Spindle and kinetochore-associated protein 2
5	9606.ENSP00000265295	0.902	Protein Spindly
6	9606.ENSP00000355922	0.900	Centromere protein F
7	9606.ENSP00000300093	0.787	Serine/threonine-protein kinase PLK1
8	9606.ENSP00000302530	0.779	Mitotic checkpoint serine/threonine-protein kinase BUB1
9	9606.ENSP00000261597	0.771	Kinetochore protein NDC80 homolog
10	9606.ENSP00000256442	0.736	G2/mitotic-specific cyclin-B1
11	9606.ENSP00000467843	0.729	Biorientation of chromosomes in cell division protein 1-like 2
12	9606.ENSP00000423505	0.714	Tetratricopeptide repeat domain containing
13	9606.ENSP00000376522	0.673	Centrosomal protein 112
14	9606.ENSP00000262519	0.602	Histone-lysine N-methyltransferase SETD1A
15	9606.ENSP00000341743	0.597	Alpha-endosulfine
16	9606.ENSP00000442924	0.586	Histone-lysine N-methyltransferase SETD1B
17	9606.ENSP00000040738	0.559	Biorientation of chromosomes in cell division protein 1-like 1
18	9606.ENSP00000390475	0.555	CXXC-type zinc finger protein 1
19	9606.ENSP00000299736	0.538	Centromere protein V
20	9606.ENSP00000365588	0.534	Mediator of DNA damage checkpoint protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140678	0.998	molecular function inhibitor activity
GO:0019902	0.995	phosphatase binding
GO:0019888	0.995	protein phosphatase regulator activity
GO:0051721	0.994	protein phosphatase 2A binding
GO:0004864	0.990	protein phosphatase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0007059	0.990	chromosome segregation
GO:0050794	0.989	regulation of cellular process
GO:1903047	0.989	mitotic cell cycle process
GO:0051172	0.980	negative regulation of nitrogen compound metabolic process
GO:0098813	0.979	nuclear chromosome segregation
GO:0051276	0.977	chromosome organization
GO:0050000	0.975	chromosome localization
GO:0051656	0.975	establishment of organelle localization
GO:0000819	0.974	sister chromatid segregation
GO:0140014	0.974	mitotic nuclear division
GO:0051310	0.973	metaphase plate congression
GO:0031324	0.969	negative regulation of cellular metabolic process
GO:0010563	0.964	negative regulation of phosphorus metabolic process
GO:0050790	0.963	regulation of catalytic activity
GO:0019220	0.961	regulation of phosphate metabolic process
GO:0010605	0.958	negative regulation of macromolecule metabolic process
GO:0008608	0.954	attachment of spindle microtubules to kinetochore
GO:0000070	0.952	mitotic sister chromatid segregation
GO:0051248	0.947	negative regulation of protein metabolic process
GO:0031399	0.942	regulation of protein modification process
GO:0043086	0.933	negative regulation of catalytic activity
GO:0031400	0.932	negative regulation of protein modification process
GO:0007080	0.930	mitotic metaphase plate congression
GO:0008104	0.922	protein localization
GO:0045936	0.917	negative regulation of phosphate metabolic process
GO:0033365	0.897	protein localization to organelle
GO:0035303	0.896	regulation of dephosphorylation
GO:0034502	0.891	protein localization to chromosome
GO:0035304	0.891	regulation of protein dephosphorylation
GO:0051315	0.820	attachment of mitotic spindle microtubules to kinetochore
GO:0051346	0.815	negative regulation of hydrolase activity
GO:0035305	0.802	negative regulation of dephosphorylation
GO:0007062	0.794	sister chromatid cohesion
GO:0010921	0.772	regulation of phosphatase activity
GO:0035308	0.766	negative regulation of protein dephosphorylation
GO:0031134	0.753	sister chromatid biorientation
GO:0071459	0.731	protein localization to chromosome, centromeric region
GO:0043666	0.710	regulation of phosphoprotein phosphatase activity
GO:0010923	0.590	negative regulation of phosphatase activity
GO:0048518	0.343	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000940	0.997	outer kinetochore
GO:0005819	0.996	spindle
GO:0000922	0.991	spindle pole
GO:0005876	0.990	spindle microtubule
GO:0048188	0.988	Set1C/COMPASS complex
GO:0005813	0.980	centrosome
GO:0005737	0.951	cytoplasm
GO:0005829	0.795	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]