StarFunc result for job id Q96IL0

User Input

>input (206 residues)
MLPCAAGARGRGAMVVLRAGKKTFLPPLCRAFACRGCQLAPERGAERRDTAPSGVSRFCP
PRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSK
EKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFA
ITFFMGKVALERIWNKLKQKQKKRSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96IL0	1.000	1.000	2.981E-34	206	1.000	1.000	Q96IL0.pdb.gz	COA8_HUMAN Cytochrome c oxidase assembly factor 8 OS=Homo sapiens OX=9606 GN=COA8 PE=1 SV=3
2	AFDB:Q9CQW7	0.721	0.773	9.633E-23	192	0.689	0.740	Q9CQW7.pdb.gz	COA8_MOUSE Cytochrome c oxidase assembly factor 8 OS=Mus musculus OX=10090 GN=Coa8 PE=1 SV=1
3	AFDB:Q9W549	0.638	0.741	9.365E-10	176	0.286	0.335	Q9W549.pdb.gz	COA8_DROME COA8 family protein CG14806, mitochondrial OS=Drosophila melanogaster OX=7227 GN=coa8 PE=3 SV=1
4	AFDB:Q3UZZ4	0.223	0.112	1.936E-1	505	0.141	0.057	Q3UZZ4.pdb.gz	OLFM4_MOUSE Olfactomedin-4 OS=Mus musculus OX=10090 GN=Olfm4 PE=2 SV=1
5	AFDB:Q9SL54	0.212	0.169	2.057E-1	262	0.170	0.134	Q9SL54.pdb.gz	Q9SL54_ARATH Basic-leucine zipper (BZIP) transcription factor family protein OS=Arabidopsis thaliana OX=3702 GN=BZIP31 PE=4 SV=1
6	AFDB:Q568Y7	0.217	0.112	2.468E-1	478	0.097	0.042	Q568Y7.pdb.gz	NOE2_RAT Noelin-2 OS=Rattus norvegicus OX=10116 GN=Olfm2 PE=1 SV=1
7	AFDB:Q09847	0.201	0.050	2.962E-1	1325	0.160	0.025	Q09847.pdb.gz	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1
8	AFDB:A8DYY6	0.260	0.102	6.143E-1	616	0.112	0.037	A8DYY6.pdb.gz	SCHI1_DROME Schwannomin-interacting protein 1 homolog OS=Drosophila melanogaster OX=7227 GN=Schip1 PE=1 SV=1
9	AFDB:Q38CZ4	0.188	0.166	7.834E-1	251	0.117	0.096	Q38CZ4.pdb.gz	Q38CZ4_TRYB2 rRNA processing protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2790 PE=3 SV=1
10	AFDB:Q14314	0.222	0.136	8.846E-1	439	0.107	0.050	Q14314.pdb.gz	FGL2_HUMAN Fibroleukin OS=Homo sapiens OX=9606 GN=FGL2 PE=1 SV=1
11	PDB:4e6kA	0.150	0.186	1.847	157	0.087	0.115	4e6kA.pdb.gz	The Structure of the BfrB-Bfd Complex Reveals Protein-Protein Interactions Enabling Iron Release from Bacterioferritin.
12	PDB:7vvuV	0.211	0.331	4.324	113	0.073	0.133	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
13	PDB:1bcfA	0.153	0.193	4.883	158	0.102	0.133	1bcfA.pdb.gz	Structure of a unique twofold symmetric haem-binding site.
14	PDB:6j6qF	0.171	0.211	4.883	161	0.068	0.087	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
15	PDB:7ocaA	0.119	0.038	7.032	775	0.063	0.017	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
16	PDB:7rjaG	0.087	0.139	7.032	122	0.073	0.123	7rjaG.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
17	PDB:5txvT	0.135	0.094	7.473	318	0.044	0.028	5txvT.pdb.gz	Covalently linked HslU hexamers support a probabilistic mechanism that links ATP hydrolysis to protein unfolding and translocation.
18	PDB:7e2qD	0.173	0.089	7.473	454	0.068	0.031	7e2qD.pdb.gz
19	PDB:6dnfA	0.153	0.141	7.941	225	0.092	0.084	6dnfA.pdb.gz
20	PDB:6elzJ	0.193	0.247	7.941	145	0.083	0.117	6elzJ.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96IL0	7.72e-156	431	206	1.000	1.000	COA8_HUMAN Cytochrome c oxidase assembly factor 8 OS=Homo sapiens OX=9606 GN=COA8 PE=1 SV=3
2	Q9CQW7	1.91e-104	300	192	0.694	0.745	COA8_MOUSE Cytochrome c oxidase assembly factor 8 OS=Mus musculus OX=10090 GN=Coa8 PE=1 SV=1
3	Q9W549	1.12e-24	97.1	176	0.296	0.347	COA8_DROME COA8 family protein CG14806, mitochondrial OS=Drosophila melanogaster OX=7227 GN=coa8 PE=3 SV=1
4	P53253	1.5	32.0	936	0.131	0.029	NNF2_YEAST Protein NNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNF2 PE=1 SV=1
5	Q53NU3	2.9	28.5	52	0.078	0.308	Q53NU3_HUMAN Uncharacterized protein tmp_locus_54 OS=Homo sapiens OX=9606 GN=tmp_locus_54 PE=1 SV=1
6	Q9FII7	4.6	30.8	1057	0.155	0.030	SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana OX=3702 GN=SMC6B PE=2 SV=1
7	G5EFP3	4.7	30.8	1573	0.087	0.011	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
8	Q15878	6.3	30.4	2313	0.063	0.006	CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens OX=9606 GN=CACNA1E PE=1 SV=3
9	Q61290	6.3	30.4	2272	0.063	0.006	CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus OX=10090 GN=Cacna1e PE=1 SV=1
10	Q07652	6.7	30.0	2222	0.063	0.006	CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus OX=10116 GN=Cacna1e PE=1 SV=1
11	Q8BSP2	9.1	29.6	607	0.073	0.025	CNDH2_MOUSE Condensin-2 complex subunit H2 OS=Mus musculus OX=10090 GN=Ncaph2 PE=1 SV=1
12	P07701	9.6	28.9	163	0.073	0.092	SGS5_DROME Salivary glue protein Sgs-5 OS=Drosophila melanogaster OX=7227 GN=Sgs5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10231 COA8	1.2e-48	175.8	Cytochrome c oxidase assembly factor 8

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386485

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000446524	0.536	Cytochrome c oxidase assembly protein COX14
2	9606.ENSP00000354762	0.534	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.496	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.966	biological regulation
GO:0050794	0.961	regulation of cellular process
GO:0008535	0.949	respiratory chain complex IV assembly
GO:0050896	0.926	response to stimulus
GO:0033617	0.899	mitochondrial cytochrome c oxidase assembly
GO:0019222	0.826	regulation of metabolic process
GO:0048522	0.815	positive regulation of cellular process
GO:0031323	0.794	regulation of cellular metabolic process
GO:0010155	0.761	regulation of proton transport
GO:0065009	0.755	regulation of molecular function
GO:0051341	0.746	regulation of oxidoreductase activity
GO:0032412	0.650	regulation of monoatomic ion transmembrane transporter activity
GO:0032414	0.615	positive regulation of ion transmembrane transporter activity
GO:0051353	0.614	positive regulation of oxidoreductase activity
GO:0048519	0.549	negative regulation of biological process
GO:0065008	0.414	regulation of biological quality
GO:0006950	0.403	response to stress
GO:0008152	0.348	metabolic process
GO:0048523	0.344	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031090	0.999	organelle membrane
GO:0031967	0.998	organelle envelope
GO:0031966	0.994	mitochondrial membrane
GO:0019866	0.929	organelle inner membrane
GO:0005743	0.922	mitochondrial inner membrane
GO:0098552	0.677	side of membrane
GO:0098576	0.507	lumenal side of membrane
GO:0099617	0.347	matrix side of mitochondrial inner membrane
GO:0070013	0.333	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]