StarFunc result for job id Q96IP4

User Input

>input (442 residues)
MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPT
AHCNVLNWEQVQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRL
NGSAASHVLHQDSGLGYKDLDLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITP
LTLKEAYVQKMVKVCNDSDRWSLISLSNNSGKNVELKFVDSLRRQFEFSVDSFQIKLDSL
LLFYECSENPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLL
VRGFRPASDEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYEYLMTLHG
VVNESTVCLMGHERRQTLNLITMLAIRVLADQNVIPNVANVTCYYQPAPYVADANFSNYY
IAQVQPVFTCQQQTYSTWLPCN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z5S8	0.851	0.842	1.568E-74	447	0.937	0.926	D3Z5S8.pdb.gz	TET5A_MOUSE Terminal nucleotidyltransferase 5A OS=Mus musculus OX=10090 GN=Tent5a PE=1 SV=2
2	AFDB:Q5SSF7	0.780	0.878	1.377E-56	391	0.629	0.711	Q5SSF7.pdb.gz	TET5C_MOUSE Terminal nucleotidyltransferase 5C OS=Mus musculus OX=10090 GN=Tent5c PE=1 SV=1
3	AFDB:Q96A09	0.771	0.801	5.229E-53	425	0.572	0.595	Q96A09.pdb.gz	TET5B_HUMAN Terminal nucleotidyltransferase 5B OS=Homo sapiens OX=9606 GN=TENT5B PE=1 SV=2
4	AFDB:Q8NEK8	0.800	0.907	2.633E-50	389	0.520	0.591	Q8NEK8.pdb.gz	TET5D_HUMAN Terminal nucleotidyltransferase 5D OS=Homo sapiens OX=9606 GN=TENT5D PE=1 SV=1
5	AFDB:A1Z743	0.746	0.380	1.077E-44	877	0.480	0.242	A1Z743.pdb.gz	A1Z743_DROME polynucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG46385 PE=3 SV=1
6	AFDB:Q94K06	0.292	0.224	4.050E-4	605	0.088	0.064	Q94K06.pdb.gz	Q94K06_ARATH Polynucleotide adenylyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22660 PE=1 SV=1
7	PDB:7buqA	0.192	0.220	1.903E-2	362	0.079	0.097	7buqA.pdb.gz	Mn2+Directly Activates cGAS and Structural Analysis Suggests Mn2+Induces a Noncanonical Catalytic Synthesis of 2'3'-cGAMP.
8	PDB:3jyyB	0.152	0.207	2.233E-2	266	0.090	0.150	3jyyB.pdb.gz	Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
9	PDB:5n9yA	0.117	0.136	2.762E-2	327	0.077	0.104	5n9yA.pdb.gz
10	AFDB:Q5U315	0.141	0.131	5.117E-2	484	0.061	0.056	Q5U315.pdb.gz	GLD2_RAT Poly(A) RNA polymerase GLD2 OS=Rattus norvegicus OX=10116 GN=Tent2 PE=1 SV=1
11	PDB:4e7xD	0.152	0.199	5.815E-2	320	0.043	0.059	4e7xD.pdb.gz
12	PDB:3jcfA	0.115	0.140	1.044E-1	349	0.081	0.103	3jcfA.pdb.gz
13	AFDB:O13657	0.123	0.082	2.150E-1	803	0.086	0.047	O13657.pdb.gz	YBCC_SCHPO Putative metal ion transporter C27B12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi066 PE=1 SV=1
14	AFDB:P43553	0.107	0.073	2.522E-1	858	0.100	0.051	P43553.pdb.gz	ALR2_YEAST Magnesium transporter ALR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALR2 PE=1 SV=1
15	AFDB:Q93Z53	0.100	0.082	2.958E-1	571	0.100	0.077	Q93Z53.pdb.gz	PKP3_ARATH Plastidial pyruvate kinase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PKP3 PE=1 SV=1
16	PDB:7pubFh	0.116	0.165	3.023E-1	274	0.038	0.062	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
17	PDB:7q3dA	0.137	0.119	3.023E-1	545	0.043	0.035	7q3dA.pdb.gz
18	PDB:2q0cB	0.198	0.261	3.943E-1	311	0.081	0.116	2q0cB.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
19	PDB:6y2pA	0.093	0.110	5.145E-1	355	0.077	0.096	6y2pA.pdb.gz
20	PDB:7q3eA	0.134	0.118	5.145E-1	551	0.068	0.054	7q3eA.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z5S8	0.0	847	447	0.937	0.926	TET5A_MOUSE Terminal nucleotidyltransferase 5A OS=Mus musculus OX=10090 GN=Tent5a PE=1 SV=2
2	Q5SSF7	0.0	567	391	0.627	0.708	TET5C_MOUSE Terminal nucleotidyltransferase 5C OS=Mus musculus OX=10090 GN=Tent5c PE=1 SV=1
3	Q5VWP2	0.0	568	391	0.627	0.708	TET5C_HUMAN Terminal nucleotidyltransferase 5C OS=Homo sapiens OX=9606 GN=TENT5C PE=1 SV=1
4	Q96IP4	0.0	918	442	1.000	1.000	TET5A_HUMAN Terminal nucleotidyltransferase 5A OS=Homo sapiens OX=9606 GN=TENT5A PE=1 SV=2
5	Q96A09	2.88e-173	494	425	0.570	0.593	TET5B_HUMAN Terminal nucleotidyltransferase 5B OS=Homo sapiens OX=9606 GN=TENT5B PE=1 SV=2
6	Q8NEK8	1.62e-165	473	389	0.518	0.589	TET5D_HUMAN Terminal nucleotidyltransferase 5D OS=Homo sapiens OX=9606 GN=TENT5D PE=1 SV=1
7	A1Z745	1.95e-131	391	529	0.471	0.393	A1Z745_DROME polynucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=CG45093 PE=3 SV=1
8	Q8SXN9	6.93e-131	390	560	0.471	0.371	Q8SXN9_DROME polynucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=CG1383 PE=2 SV=1
9	A1Z743	6.02e-128	393	877	0.471	0.237	A1Z743_DROME polynucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG46385 PE=3 SV=1
10	Q75QN2	2.0	33.5	995	0.068	0.030	INT8_HUMAN Integrator complex subunit 8 OS=Homo sapiens OX=9606 GN=INTS8 PE=1 SV=1
11	P35577	3.5	32.3	418	0.059	0.062	THBG_RAT Thyroxine-binding globulin OS=Rattus norvegicus OX=10116 GN=Serpina7 PE=1 SV=2
12	Q9LFP7	5.8	31.6	493	0.038	0.034	PBL34_ARATH Serine/threonine-protein kinase PBL34 OS=Arabidopsis thaliana OX=3702 GN=PBL34 PE=1 SV=1
13	Q9CZR2	9.4	31.2	740	0.075	0.045	NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus OX=10090 GN=Naalad2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07984 NTP_transf_7	1e-153	522.9	Nucleotidyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318298

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358831	0.910	Elongation of very long chain fatty acids protein 4
2	9606.ENSP00000287727	0.715	Zinc finger FYVE domain-containing protein 9
3	9606.ENSP00000357748	0.673	BRCA2 and CDKN1A-interacting protein
4	9606.ENSP00000367823	0.651	Protein FAM214B
5	9606.ENSP00000357545	0.642	Protein FAM162B
6	9606.ENSP00000311528	0.630	Probable G-protein coupled receptor 162
7	9606.ENSP00000424707	0.622	Protein kish-A
8	9606.ENSP00000368835	0.613	Protein yippee-like 5
9	9606.ENSP00000390783	0.610	Sec1 family domain-containing protein 1
10	9606.ENSP00000254442	0.588	WD repeat-containing protein 7
11	9606.ENSP00000244769	0.567	Ataxin-1
12	9606.ENSP00000340668	0.550	Transmembrane protein 248
13	9606.ENSP00000300896	0.534	Ubiquitin specific peptidase 32
14	9606.ENSP00000257940	0.526	Zinc finger CCCH domain-containing protein 10
15	9606.ENSP00000376767	0.513	Uncharacterized protein NKAPD1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990817	1.000	RNA adenylyltransferase activity
GO:0005515	0.997	protein binding
GO:0097159	0.397	organic cyclic compound binding
GO:1901363	0.396	heterocyclic compound binding
GO:0003676	0.316	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.912	positive regulation of biological process
GO:0048522	0.813	positive regulation of cellular process
GO:0050896	0.728	response to stimulus
GO:0050793	0.585	regulation of developmental process
GO:0060255	0.536	regulation of macromolecule metabolic process
GO:0045595	0.499	regulation of cell differentiation
GO:0051094	0.497	positive regulation of developmental process
GO:0030278	0.470	regulation of ossification
GO:0070167	0.463	regulation of biomineral tissue development
GO:0051171	0.452	regulation of nitrogen compound metabolic process
GO:0080090	0.450	regulation of primary metabolic process
GO:0031323	0.425	regulation of cellular metabolic process
GO:0009987	0.400	cellular process
GO:0048523	0.395	negative regulation of cellular process
GO:0010468	0.388	regulation of gene expression
GO:0044419	0.374	biological process involved in interspecies interaction between organisms
GO:0009893	0.371	positive regulation of metabolic process
GO:0009607	0.347	response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0070013	0.924	intracellular organelle lumen
GO:0005634	0.884	nucleus
GO:0005654	0.871	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11332	1.000	ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide
EC:2.7.7.19	1.000	polynucleotide adenylyltransferase.

[back to server]