StarFunc result for job id Q96IR2

User Input

>input (970 residues)
MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMKEFSS
TAQGNTEVIHTGTLQRHERHHIGDFCFQEMEKDIHDFEFQWKEDERNSHEAPMTEIKQLT
GSTNRHDQRHAGNKPIKDQLGSSFHSHLPELHMFQTEGKIGNQVEKSINSASLVSTSQRI
SCRPKTHISKNYGNNFLNSSLLTQKQEVHMREKSFQCNESGKAFNYSSVLRKHQIIHLGA
KQYKCDVCGKVFNQKRYLACHRRCHTGKKPYKCNDCGKTFSQELTLTCHHRLHTGEKHYK
CSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEEC
DKAFSFKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTF
SQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTS
SLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTR
HCRLHTGEKPYQCNECGKAFRGQSALIYHQAIHGIGKLYKCNDCHQVFSNATTIANHWRI
HNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGE
KPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALIIHKAIHTGEKPYK
CNECGKAFSQKSSLTCHLRLHTGEKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVC
DKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTF
RHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLHTGEKPYKCNKCGKVFNQQA
HLACHHRIHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLAR
HHRIHTGKKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05481	0.383	0.324	5.264E-86	1191	0.528	0.430	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
2	AFDB:Q6ZNG1	0.316	0.404	2.710E-77	722	0.527	0.708	Q6ZNG1.pdb.gz	ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens OX=9606 GN=ZNF600 PE=1 SV=2
3	AFDB:A0A1B0GR71	0.423	0.424	6.045E-77	966	0.418	0.419	A0A1B0GR71.pdb.gz	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
4	AFDB:Q5DTF8	0.301	0.316	1.932E-74	919	0.431	0.455	Q5DTF8.pdb.gz	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
5	AFDB:Q9UII5	0.392	0.460	3.724E-73	783	0.411	0.510	Q9UII5.pdb.gz	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
6	AFDB:P17038	0.300	0.352	3.272E-68	809	0.425	0.509	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
7	AFDB:Q96JF6	0.234	0.277	1.349E-64	807	0.370	0.445	Q96JF6.pdb.gz	ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens OX=9606 GN=ZNF594 PE=2 SV=3
8	AFDB:Q62788	0.274	0.350	7.806E-64	744	0.370	0.483	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
9	AFDB:A6NNF4	0.289	0.371	9.112E-63	738	0.408	0.537	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
10	AFDB:A6NHJ4	0.227	0.327	1.059E-62	632	0.495	0.759	A6NHJ4.pdb.gz	ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens OX=9606 GN=ZNF860 PE=1 SV=3
11	PDB:3w5kB	0.058	0.266	1.799E-3	110	0.042	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4kblA	0.042	0.075	2.331E-1	395	0.060	0.147	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
13	PDB:5c8dE	0.044	0.101	9.493E-1	280	0.021	0.071	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
14	PDB:5ijnC	0.088	0.110	9.493E-1	636	0.080	0.123	5ijnC.pdb.gz
15	PDB:5dkaA	0.032	0.229	1.491	96	0.020	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
16	PDB:7dn3O	0.047	0.078	1.567	443	0.045	0.099	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
17	PDB:6hivCv	0.044	0.041	2.227	1059	0.064	0.059	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
18	PDB:2ad5B	0.039	0.053	2.588	536	0.020	0.035	2ad5B.pdb.gz	Mechanisms of Product Feedback Regulation and Drug Resistance in Cytidine Triphosphate Synthetases from the Structure of a CTP-Inhibited Complex(,).
19	PDB:5gm6a	0.025	0.101	2.861	123	0.024	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:2is6A	0.048	0.061	3.163	654	0.039	0.058	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WSF4	541	635	0.284	0.433	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
2	A0A0U1RQ46	575	609	0.307	0.489	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
3	A0A1B0GR71	698	966	0.448	0.450	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
4	A0A8I6G8Y2	570	723	0.298	0.400	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
5	A2AWF2	545	685	0.308	0.436	A2AWF2_MOUSE Reduced expression 2 OS=Mus musculus OX=10090 GN=Rex2 PE=1 SV=1
6	A2RRD8	653	509	0.345	0.658	ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1
7	A6NHJ4	551	632	0.287	0.440	ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens OX=9606 GN=ZNF860 PE=1 SV=3
8	A8K8Y5	547	707	0.281	0.386	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
9	E9Q981	541	636	0.284	0.432	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
10	F8WEC7	557	859	0.353	0.398	F8WEC7_HUMAN Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1
11	G3V9G6	571	740	0.298	0.391	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
12	P15620	564	580	0.281	0.471	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
13	P17020	544	682	0.279	0.397	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
14	P17027	545	643	0.277	0.418	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
15	P17038	664	809	0.357	0.428	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
16	P35789	540	620	0.279	0.437	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
17	P51522	574	516	0.302	0.568	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3
18	P51523	589	738	0.309	0.407	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
19	P51814	553	821	0.305	0.361	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
20	Q02386	550	682	0.287	0.408	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	9.3e-05	34.0	BolA-like protein
2	PF00130 C1_1	4.5e-10	50.6	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF12773 DZR	0.00027	32.2	Double zinc ribbon
4	PF01155 HypA	1.1	20.8	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
5	PF01352 KRAB	6e-23	91.5	KRAB box
6	PF01429 MBD	0.44	21.6	Methyl-CpG binding domain
7	PF01286 XPA_N	2	19.8	XPA protein N-terminal
8	PF01428 zf-AN1	67	15.1	AN1-like Zinc finger
9	PF00096 zf-C2H2	1.6e-130	429.9	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	3.2e-20	82.9	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	2.7e-62	213.0	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	2.3e-23	92.9	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	2.8e-14	64.2	Zinc-finger double-stranded RNA-binding
14	PF13465 zf-H2C2_2	9.3e-188	612.6	Zinc-finger double domain
15	PF13909 zf-H2C2_5	1.2e-08	45.8	C2H2-type zinc-finger domain
16	PF12874 zf-met	1.4	20.7	Zinc-finger of C2H2 type
17	PF18439 zf_UBZ	3.5e-06	37.9	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	9.2e-07	40.9	zinc-ribbon family
19	PF09723 Zn-ribbon_8	1.6e-17	74.6	Zinc ribbon domain
20	PF17283 Zn_ribbon_SprT	2.2e-05	35.6	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388311

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299320	0.653	Uncharacterized protein C16orf71
2	9606.ENSP00000357320	0.642	28S ribosomal protein S29, mitochondrial
3	9606.ENSP00000479281	0.636	Uncharacterized protein LOC400658
4	9606.ENSP00000310856	0.603	Vomeronasal type-1 receptor 4
5	9606.ENSP00000332500	0.517	Olfactory receptor 4N4
6	9606.ENSP00000480318	0.517	Olfactory receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0031326	0.975	regulation of cellular biosynthetic process
GO:0051252	0.975	regulation of RNA metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0010556	0.939	regulation of macromolecule biosynthetic process
GO:0006355	0.933	regulation of DNA-templated transcription
GO:0048523	0.924	negative regulation of cellular process
GO:0009892	0.900	negative regulation of metabolic process
GO:0045892	0.807	negative regulation of DNA-templated transcription
GO:0009987	0.481	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.994	nucleoplasm
GO:0016020	0.652	membrane
GO:0005737	0.322	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]