StarFunc result for job id Q96IR7

User Input

>input (371 residues)
MAAPALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGA
GSGEPLYGLDPRHAVPSATNLCFDVADAGAATRELAALGCSVPVPPVRVRDAQGAATYAV
VSSPAGILSLTLLERAGYRGPFLPGFRPVSSAPGPGWVSRVDHLTLACTPGSSPTLLRWF
HDCLGFCHLPLSPGEDPELGLEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTR
QDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAA
GHEPHLLARQGILLDGDKGKFLLQVFTKSLFTEDTFFLELIQRQGATGFGQGNIRALWQS
VQEQSARSQEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96IR7	1.000	1.000	7.004E-86	371	1.000	1.000	Q96IR7.pdb.gz	HPDL_HUMAN 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens OX=9606 GN=HPDL PE=1 SV=1
2	AFDB:Q8K248	0.987	0.987	2.257E-71	371	0.787	0.787	Q8K248.pdb.gz	HPDL_MOUSE 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Mus musculus OX=10090 GN=Hpdl PE=2 SV=1
3	AFDB:C8VKK0	0.845	0.785	8.568E-34	401	0.261	0.242	C8VKK0.pdb.gz	C8VKK0_EMENI 4-hydroxyphenylpyruvate dioxygenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01899 PE=3 SV=1
4	AFDB:Q76NV5	0.850	0.859	1.083E-33	367	0.248	0.251	Q76NV5.pdb.gz	HPPD_DICDI 4-hydroxyphenylpyruvate dioxygenase OS=Dictyostelium discoideum OX=44689 GN=hpd PE=1 SV=1
5	AFDB:Q4WHU1	0.847	0.783	1.368E-33	403	0.248	0.228	Q4WHU1.pdb.gz	HPPD1_ASPFU 4-hydroxyphenylpyruvate dioxygenase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=hppD PE=1 SV=1
6	AFDB:P32754	0.853	0.808	1.597E-32	393	0.235	0.221	P32754.pdb.gz	HPPD_HUMAN 4-hydroxyphenylpyruvate dioxygenase OS=Homo sapiens OX=9606 GN=HPD PE=1 SV=2
7	AFDB:O52791	0.835	0.866	8.217E-32	357	0.243	0.252	O52791.pdb.gz	HMAS_AMYOR 4-hydroxymandelate synthase OS=Amycolatopsis orientalis OX=31958 PE=1 SV=1
8	PDB:5ec3A	0.841	0.830	3.906E-31	376	0.235	0.231	5ec3A.pdb.gz	Structural insight into the catalyitc mechanism of human 4-Hydroxyphenylpyruvate dioxygenase
9	PDB:2r5vA	0.825	0.880	6.613E-31	346	0.243	0.260	2r5vA.pdb.gz	Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate.
10	AFDB:P32755	0.849	0.804	1.445E-30	393	0.229	0.216	P32755.pdb.gz	HPPD_RAT 4-hydroxyphenylpyruvate dioxygenase OS=Rattus norvegicus OX=10116 GN=Hpd PE=1 SV=3
11	AFDB:P93836	0.828	0.699	1.590E-29	445	0.275	0.229	P93836.pdb.gz	HPPD_ARATH 4-hydroxyphenylpyruvate dioxygenase OS=Arabidopsis thaliana OX=3702 GN=HPD PE=1 SV=2
12	PDB:7x5rA	0.766	0.739	3.972E-29	386	0.275	0.264	7x5rA.pdb.gz	Structural insights of 4-Hydrophenylpyruvate dioxygenase inhibition by structurally diverse small molecules
13	PDB:1sqiB	0.760	0.820	2.682E-27	342	0.218	0.237	1sqiB.pdb.gz	Structural basis for herbicidal inhibitor selectivity revealed by comparison of crystal structures of plant and Mammalian 4-hydroxyphenylpyruvate dioxygenases
14	AFDB:O06695	0.762	0.790	5.858E-27	357	0.221	0.230	O06695.pdb.gz	VLLY_VIBVU Hemolysin VllY OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=vllY PE=3 SV=2
15	PDB:5xgkA	0.747	0.753	1.228E-26	368	0.256	0.258	5xgkA.pdb.gz	Crystal Structure of 4-Hydroxyphenylpyruvate Dioxygenase in Complex with Substrate Reveals a New Starting Point for Herbicide Discovery.
16	PDB:5hmqD	0.681	0.423	7.785E-22	624	0.224	0.133	5hmqD.pdb.gz	Structure of a putative xylose isomerase-like TIM barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein from Pseudomonas putida at 2.4 Angstroms resolution.
17	PDB:3oxhA	0.449	0.619	1.223E-9	251	0.116	0.171	3oxhA.pdb.gz	Structural and Biophysical Characterization of the Mycobacterium tuberculosis Protein Rv0577, a Protein Associated with Neutral Red Staining of Virulent Tuberculosis Strains and Homologue of the Streptomyces coelicolor Protein KbpA.
18	PDB:2zi8A	0.470	0.565	4.979E-9	299	0.132	0.164	2zi8A.pdb.gz	Studies of a ring-cleaving dioxygenase illuminate the role of cholesterol metabolism in the pathogenesis of Mycobacterium tuberculosis.
19	PDB:1fa5A	0.136	0.342	9.800E-5	128	0.062	0.180	1fa5A.pdb.gz	Determination of the structure of Escherichia coli glyoxalase I suggests a structural basis for differential metal activation.
20	PDB:1k4nA	0.176	0.295	4.756E-4	183	0.070	0.142	1k4nA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K248	0.0	580	371	0.787	0.787	HPDL_MOUSE 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Mus musculus OX=10090 GN=Hpdl PE=2 SV=1
2	Q96IR7	0.0	742	371	1.000	1.000	HPDL_HUMAN 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens OX=9606 GN=HPDL PE=1 SV=1
3	Q76NV5	6.06e-35	133	367	0.270	0.272	HPPD_DICDI 4-hydroxyphenylpyruvate dioxygenase OS=Dictyostelium discoideum OX=44689 GN=hpd PE=1 SV=1
4	C8VKK0	8.31e-34	131	401	0.272	0.252	C8VKK0_EMENI 4-hydroxyphenylpyruvate dioxygenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01899 PE=3 SV=1
5	Q4WHU1	2.58e-31	124	403	0.270	0.248	HPPD1_ASPFU 4-hydroxyphenylpyruvate dioxygenase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=hppD PE=1 SV=1
6	P49429	3.71e-26	110	393	0.264	0.249	HPPD_MOUSE 4-hydroxyphenylpyruvate dioxygenase OS=Mus musculus OX=10090 GN=Hpd PE=1 SV=3
7	P32754	7.71e-26	109	393	0.245	0.232	HPPD_HUMAN 4-hydroxyphenylpyruvate dioxygenase OS=Homo sapiens OX=9606 GN=HPD PE=1 SV=2
8	O52791	2.08e-25	107	357	0.253	0.263	HMAS_AMYOR 4-hydroxymandelate synthase OS=Amycolatopsis orientalis OX=31958 PE=1 SV=1
9	P32755	5.94e-25	106	393	0.256	0.242	HPPD_RAT 4-hydroxyphenylpyruvate dioxygenase OS=Rattus norvegicus OX=10116 GN=Hpd PE=1 SV=3
10	O06695	9.51e-21	94.4	357	0.253	0.263	VLLY_VIBVU Hemolysin VllY OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=vllY PE=3 SV=2
11	Q02110	4.53e-18	87.0	393	0.167	0.158	HPPD_PIG 4-hydroxyphenylpyruvate dioxygenase OS=Sus scrofa OX=9823 GN=HPD PE=1 SV=4
12	P93836	4.59e-13	72.4	445	0.221	0.184	HPPD_ARATH 4-hydroxyphenylpyruvate dioxygenase OS=Arabidopsis thaliana OX=3702 GN=HPD PE=1 SV=2
13	Q88JU3	0.005	41.2	635	0.170	0.099	DSD_PSEPK 3-dehydroshikimate dehydratase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=quiC1 PE=1 SV=1
14	Q9I6P6	0.30	35.8	634	0.237	0.139	DSD_PSEAE 3-dehydroshikimate dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=quiC1 PE=3 SV=1
15	Q38A83	2.9	32.7	1664	0.062	0.014	Q38A83_TRYB2 Nucleoporin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1530 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00903 Glyoxalase	1	21.0	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
2	PF13468 Glyoxalase_3	2.7e+02	13.1	Glyoxalase-like domain
3	PF13669 Glyoxalase_4	0.49	22.1	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335060

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283871	0.946	Homogentisate 1,2-dioxygenase
2	9606.ENSP00000348234	0.826	Tyrosine aminotransferase
3	9606.ENSP00000385080	0.790	Fumarylacetoacetase
4	9606.ENSP00000302552	0.720	Glyoxalase domain containing 5
5	9606.ENSP00000243326	0.632	Telomere-associated protein RIF1
6	9606.ENSP00000359211	0.602	Dihydropyrimidine dehydrogenase [NADP(+)]
7	9606.ENSP00000444788	0.577	Tryptophan 2,3-dioxygenase
8	9606.ENSP00000361524	0.557	Telomere length and silencing protein 1 homolog
9	9606.ENSP00000369409	0.556	Exocyst complex component 3 like 4
10	9606.ENSP00000271526	0.538	Proline-rich protein PRCC
11	9606.ENSP00000301329	0.525	Glyoxalase domain containing 4
12	9606.ENSP00000324343	0.517	Beta-ureidopropionase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016702	1.000	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0042802	0.986	identical protein binding
GO:0043167	0.958	ion binding
GO:0046872	0.946	metal ion binding
GO:0042803	0.917	protein homodimerization activity
GO:0003868	0.908	4-hydroxyphenylpyruvate dioxygenase activity
GO:0046914	0.477	transition metal ion binding
GO:0005506	0.404	iron ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:0006725	0.991	cellular aromatic compound metabolic process
GO:1901564	0.987	organonitrogen compound metabolic process
GO:0044238	0.976	primary metabolic process
GO:0006082	0.958	organic acid metabolic process
GO:1901360	0.957	organic cyclic compound metabolic process
GO:0019752	0.946	carboxylic acid metabolic process
GO:0044282	0.724	small molecule catabolic process
GO:0046395	0.698	carboxylic acid catabolic process
GO:1901565	0.588	organonitrogen compound catabolic process
GO:0006520	0.557	amino acid metabolic process
GO:0009058	0.499	biosynthetic process
GO:0034641	0.473	cellular nitrogen compound metabolic process
GO:1901576	0.467	organic substance biosynthetic process
GO:0019439	0.461	aromatic compound catabolic process
GO:0044249	0.437	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005829	0.425	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.13.11.-	1.000	With incorporation of two atoms of oxygen.
RHEA:16189	0.908	3-(4-hydroxyphenyl)pyruvate + O2 = CO2 + homogentisate
EC:1.13.11.27	0.908	4-hydroxyphenylpyruvate dioxygenase.

[back to server]