StarFunc result for job id Q96IU2

User Input

>input (234 residues)
MRSGEPACTMDQARGLDDAAARGGQCPGLGPAPTPTPPGRLGAPYSEAWGYFHLAPGRPG
HPSGHWATCRLCGEQVGRGPGFHAGTSALWRHLRSAHRRELESSGAGSSPPAAPCPPPPG
PAAAPEGDWARLLEQMGALAVRGSRRERELERRELAVEQGERALERRRRALQEEERAAAQ
ARRELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96IU2	0.999	0.999	2.605E-34	234	1.000	1.000	Q96IU2.pdb.gz	ZBED3_HUMAN Zinc finger BED domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED3 PE=1 SV=1
2	AFDB:Q9BTP6	0.324	0.345	2.394E-13	218	0.419	0.450	Q9BTP6.pdb.gz	ZBED2_HUMAN Zinc finger BED domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZBED2 PE=1 SV=2
3	AFDB:Q9D0L1	0.568	0.581	2.028E-12	228	0.521	0.535	Q9D0L1.pdb.gz	ZBED3_MOUSE Zinc finger BED domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zbed3 PE=1 SV=1
4	AFDB:Q0JMB2	0.210	0.085	2.853E-2	684	0.103	0.035	Q0JMB2.pdb.gz	RSLE4_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0518400 PE=2 SV=3
5	AFDB:A0A669KBH9	0.119	0.033	1.416E-1	1066	0.137	0.030	A0A669KBH9.pdb.gz	A0A669KBH9_HUMAN WIZ zinc finger OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=1
6	AFDB:Q580V9	0.126	0.033	2.583E-1	1232	0.111	0.021	Q580V9.pdb.gz	Q580V9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.190 PE=4 SV=1
7	AFDB:Q9VHG6	0.251	0.295	2.952E-1	195	0.154	0.185	Q9VHG6.pdb.gz	Q9VHG6_DROME Insulator binding factor 2 OS=Drosophila melanogaster OX=7227 GN=Ibf2 PE=1 SV=1
8	PDB:4btsA9	0.098	0.182	3.900E-1	93	0.043	0.108	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
9	AFDB:A0A5E4M3Q4	0.305	0.141	5.036E-1	554	0.162	0.069	A0A5E4M3Q4.pdb.gz	SYD9_CAEEL Zinc finger protein syd-9 OS=Caenorhabditis elegans OX=6239 GN=syd-9 PE=1 SV=1
10	AFDB:Q9SZH7	0.100	0.106	6.577E-1	220	0.038	0.041	Q9SZH7.pdb.gz	Q9SZH7_ARATH C2H2-like zinc finger protein OS=Arabidopsis thaliana OX=3702 GN=At4g26030 PE=4 SV=1
11	AFDB:Q5T4T6	0.147	0.056	1.282	812	0.111	0.032	Q5T4T6.pdb.gz	SYC2L_HUMAN Synaptonemal complex protein 2-like OS=Homo sapiens OX=9606 GN=SYCP2L PE=1 SV=2
12	PDB:4v6wCp	0.092	0.183	1.482	91	0.056	0.143	4v6wCp.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:5apnp	0.087	0.162	1.482	91	0.056	0.143	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
14	PDB:1n3gA	0.096	0.162	1.936	113	0.038	0.080	1n3gA.pdb.gz
15	PDB:6g90U	0.100	0.117	2.213	196	0.064	0.077	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
16	PDB:7mq8SB	0.083	0.053	2.366	440	0.043	0.023	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:1m4mA	0.154	0.284	2.703	112	0.038	0.080	1m4mA.pdb.gz	CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN
18	PDB:1o80A	0.076	0.184	2.890	74	0.030	0.095	1o80A.pdb.gz
19	PDB:7v61B	0.078	0.034	3.303	751	0.056	0.017	7v61B.pdb.gz
20	PDB:2mp1A	0.118	0.249	3.775	77	0.038	0.117	2mp1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96IU2	5.84e-162	449	234	1.000	1.000	ZBED3_HUMAN Zinc finger BED domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED3 PE=1 SV=1
2	Q9D0L1	4.02e-52	170	228	0.504	0.518	ZBED3_MOUSE Zinc finger BED domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zbed3 PE=1 SV=1
3	Q9BTP6	3.04e-49	162	218	0.376	0.404	ZBED2_HUMAN Zinc finger BED domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZBED2 PE=1 SV=2
4	P86452	2.34e-04	44.3	979	0.107	0.026	ZBED6_HUMAN Zinc finger BED domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBED6 PE=1 SV=1
5	D2EAC2	3.92e-04	43.5	980	0.107	0.026	ZBED6_MOUSE Zinc finger BED domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zbed6 PE=1 SV=1
6	Q94513	0.001	41.6	282	0.111	0.092	Q94513_DROME Boundary element associated factor OS=Drosophila melanogaster OX=7227 GN=BEAF-32 PE=1 SV=1
7	Q0E8J5	0.035	37.7	2960	0.137	0.011	Q0E8J5_DROME Zormin, isoform K OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
8	Q7Z1Y4	0.039	37.4	2935	0.137	0.011	Q7Z1Y4_DROME Zormin OS=Drosophila melanogaster OX=7227 GN=zormin PE=4 SV=1
9	Q9W053	0.039	37.4	2935	0.137	0.011	Q9W053_DROME Zormin, isoform F OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=4
10	Q0E8J4	0.040	37.4	3079	0.128	0.010	Q0E8J4_DROME Zormin, isoform G OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
11	O75132	0.045	37.4	1171	0.107	0.021	ZBED4_HUMAN Zinc finger BED domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBED4 PE=1 SV=2
12	P78559	0.048	37.4	2803	0.090	0.007	MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6
13	A6QLN6	0.065	37.0	1972	0.132	0.016	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
14	M9PE03	0.065	37.0	3536	0.128	0.008	M9PE03_DROME Zormin, isoform E OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
15	Q0E8J3	0.068	36.6	3640	0.128	0.008	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
16	Q586X2	0.076	36.6	833	0.094	0.026	Q586X2_TRYB2 Translation initiation factor IF-2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.240 PE=3 SV=1
17	M9PBJ1	0.079	36.6	3664	0.128	0.008	M9PBJ1_DROME Zormin, isoform J OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
18	A1Z7Z9	0.11	35.8	1134	0.120	0.025	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
19	Q9JIL8	0.18	35.4	1312	0.098	0.018	RAD50_RAT DNA repair protein RAD50 OS=Rattus norvegicus OX=10116 GN=Rad50 PE=1 SV=1
20	Q9NZM3	0.18	35.4	1697	0.073	0.010	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04028 DUF374	1.5e+02	13.3	Domain of unknown function (DUF374)
2	PF03938 OmpH	7.5e+02	11.8	Outer membrane protein (OmpH-like)
3	PF12072 RNase_Y_N	3.5e+02	12.0	RNase Y N-terminal region
4	PF02892 zf-BED	1.4e-05	36.3	BED zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.894	Axin-1
2	9606.ENSP00000363329	0.676	High affinity copper uptake protein 1
3	9606.ENSP00000261749	0.663	AN1-type zinc finger protein 6
4	9606.ENSP00000377233	0.612	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
5	9606.ENSP00000281141	0.565	Cell division cycle protein 123 homolog
6	9606.ENSP00000463287	0.562	Kruppel like factor 14
7	9606.ENSP00000274695	0.561	Threonylcarbamoyladenosine tRNA methylthiotransferase
8	9606.ENSP00000438209	0.561	Transcription factor Sp6
9	9606.ENSP00000347712	0.558	C2 calcium-dependent domain-containing protein 4A
10	9606.ENSP00000385780	0.558	Diacylglycerol kinase beta
11	9606.ENSP00000345853	0.519	Dual specificity protein phosphatase 9
12	9606.ENSP00000478874	0.519	Calcium/calmodulin-dependent protein kinase type 1D
13	9606.ENSP00000287218	0.518	Zinc finger AN1-type containing 3
14	9606.ENSP00000371634	0.517	Insulin-like growth factor 2 mRNA-binding protein 2
15	9606.ENSP00000385995	0.503	Thyroid adenoma-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.668	organic cyclic compound binding
GO:1901363	0.650	heterocyclic compound binding
GO:0003676	0.609	nucleic acid binding
GO:0003824	0.338	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.939	response to stimulus
GO:0042221	0.919	response to chemical
GO:0010033	0.896	response to organic substance
GO:0032868	0.870	response to insulin
GO:0050789	0.826	regulation of biological process
GO:0050794	0.823	regulation of cellular process
GO:0009743	0.759	response to carbohydrate
GO:0034284	0.749	response to monosaccharide
GO:0009749	0.700	response to glucose
GO:0009987	0.586	cellular process
GO:0019222	0.378	regulation of metabolic process
GO:0048518	0.369	positive regulation of biological process
GO:0010468	0.356	regulation of gene expression
GO:0080090	0.327	regulation of primary metabolic process
GO:0048519	0.321	negative regulation of biological process
GO:0048523	0.311	negative regulation of cellular process
GO:0051252	0.305	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.969	intracellular anatomical structure
GO:0043227	0.956	membrane-bounded organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0005634	0.919	nucleus
GO:0005576	0.903	extracellular region
GO:0005615	0.838	extracellular space
GO:0005737	0.759	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]