StarFunc result for job id Q96IU4

User Input

>input (210 residues)
MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQA
GYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPF
LTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRV
LIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96IU4	1.000	1.000	1.208E-48	210	1.000	1.000	Q96IU4.pdb.gz	ABHEB_HUMAN Putative protein-lysine deacylase ABHD14B OS=Homo sapiens OX=9606 GN=ABHD14B PE=1 SV=1
2	PDB:1imjA	0.967	0.976	1.791E-41	208	0.957	0.966	1imjA.pdb.gz
3	AFDB:Q922Q6	0.883	0.755	3.191E-24	247	0.433	0.368	Q922Q6.pdb.gz	ABHEA_MOUSE Protein ABHD14A OS=Mus musculus OX=10090 GN=Abhd14a PE=1 SV=2
4	PDB:2ocgA	0.743	0.624	5.355E-12	254	0.229	0.189	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
5	AFDB:P77044	0.732	0.548	1.251E-11	288	0.233	0.170	P77044.pdb.gz	MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mhpC PE=1 SV=4
6	AFDB:Q86WA6	0.750	0.553	6.030E-11	291	0.229	0.165	Q86WA6.pdb.gz	BPHL_HUMAN Valacyclovir hydrolase OS=Homo sapiens OX=9606 GN=BPHL PE=1 SV=1
7	AFDB:B3H7N1	0.744	0.449	6.838E-11	369	0.224	0.127	B3H7N1.pdb.gz	B3H7N1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL15 PE=1 SV=1
8	AFDB:P9WNH3	0.731	0.465	7.282E-11	341	0.219	0.135	P9WNH3.pdb.gz	Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2715 PE=1 SV=1
9	AFDB:Q9LYG5	0.749	0.425	7.282E-11	390	0.229	0.123	Q9LYG5.pdb.gz	Q9LYG5_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL13 PE=1 SV=1
10	AFDB:Q9VD00	0.746	0.575	7.282E-11	278	0.210	0.158	Q9VD00.pdb.gz	Q9VD00_DROME FI07666p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5377 PE=1 SV=1
11	PDB:1u2eA	0.735	0.555	7.518E-11	286	0.229	0.168	1u2eA.pdb.gz
12	AFDB:O22248	0.701	0.444	8.258E-11	351	0.200	0.120	O22248.pdb.gz	O22248_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL9 PE=1 SV=2
13	AFDB:F4IZK0	0.724	0.463	9.365E-11	348	0.229	0.138	F4IZK0.pdb.gz	F4IZK0_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL12 PE=1 SV=1
14	PDB:3e3aB	0.714	0.559	1.243E-10	275	0.195	0.149	3e3aB.pdb.gz
15	PDB:5jzsB	0.687	0.523	2.245E-9	284	0.243	0.180	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
16	PDB:6eicB	0.758	0.586	4.211E-9	279	0.171	0.129	6eicB.pdb.gz
17	PDB:5aljA	0.710	0.303	4.485E-9	523	0.262	0.105	5aljA.pdb.gz	Successful Generation of Structural Information for Fragment-Based Drug Discovery.
18	PDB:1m33A	0.638	0.534	8.958E-9	256	0.210	0.172	1m33A.pdb.gz	Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli.
19	PDB:3fcxB	0.653	0.522	1.082E-8	275	0.162	0.124	3fcxB.pdb.gz	Crystal structure of human esterase D: a potential genetic marker of retinoblastoma
20	PDB:6y0fC	0.690	0.232	1.391E-8	722	0.181	0.053	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96IU4	6.03e-154	426	210	1.000	1.000	ABHEB_HUMAN Putative protein-lysine deacylase ABHD14B OS=Homo sapiens OX=9606 GN=ABHD14B PE=1 SV=1
2	V9HW87	6.03e-154	426	210	1.000	1.000	V9HW87_HUMAN Abhydrolase domain containing 14B, isoform CRA_a OS=Homo sapiens OX=9606 GN=HEL-S-299 PE=2 SV=1
3	F8W9U3	1.49e-138	387	208	0.929	0.938	F8W9U3_HUMAN Abhydrolase domain containing 14B OS=Homo sapiens OX=9606 GN=ABHD14B PE=1 SV=1
4	Q922Q6	1.27e-50	166	247	0.429	0.364	ABHEA_MOUSE Protein ABHD14A OS=Mus musculus OX=10090 GN=Abhd14a PE=1 SV=2
5	P77044	3.34e-05	45.8	288	0.148	0.108	MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mhpC PE=1 SV=4
6	F4KBJ3	0.004	39.7	374	0.105	0.059	F4KBJ3_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CLD1 PE=1 SV=1
7	E5RFH6	0.012	38.5	372	0.162	0.091	E5RFH6_HUMAN Epoxide hydrolase 2 OS=Homo sapiens OX=9606 GN=EPHX2 PE=1 SV=1
8	P34913	0.013	38.5	555	0.162	0.061	HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens OX=9606 GN=EPHX2 PE=1 SV=2
9	P9WNH5	0.025	37.4	291	0.143	0.103	HSAD_MYCTU 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hsaD PE=1 SV=1
10	O14249	0.044	36.6	428	0.090	0.044	CLD1_SCHPO Probable cardiolipin-specific deacylase 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.03c PE=3 SV=1
11	Q8R2Y0	0.073	35.8	336	0.081	0.051	ABHD6_MOUSE Monoacylglycerol lipase ABHD6 OS=Mus musculus OX=10090 GN=Abhd6 PE=1 SV=1
12	P9WNH3	0.090	35.8	341	0.162	0.100	Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2715 PE=1 SV=1
13	B3H7N1	0.091	35.8	369	0.176	0.100	B3H7N1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL15 PE=1 SV=1
14	Q8LFX7	0.11	35.4	469	0.095	0.043	BDG1_ARATH Probable lysophospholipase BODYGUARD 1 OS=Arabidopsis thaliana OX=3702 GN=BDG1 PE=2 SV=1
15	Q9BV23	0.11	35.4	337	0.081	0.050	ABHD6_HUMAN Monoacylglycerol lipase ABHD6 OS=Homo sapiens OX=9606 GN=ABHD6 PE=1 SV=1
16	Q12385	0.14	35.0	394	0.095	0.051	ICT1_YEAST 1-acylglycerol-3-phosphate O-acyltransferase ICT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ICT1 PE=3 SV=1
17	Q8VZ57	0.18	34.7	380	0.157	0.087	Q8VZ57_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g52510 PE=1 SV=1
18	Q9M9W5	0.18	34.7	331	0.138	0.088	Q9M9W5_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ATEH1 PE=1 SV=1
19	O48789	0.24	34.3	320	0.152	0.100	O48789_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g26750 PE=2 SV=1
20	D7SFQ6	0.29	34.3	441	0.143	0.068	D7SFQ6_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-25 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	1.2e-07	43.2	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	63	14.7	Alpha/beta hydrolase domain
3	PF12697 Abhydrolase_6	1.1e-08	47.5	Alpha/beta hydrolase family
4	PF01738 DLH	1.5e+02	13.3	Dienelactone hydrolase family
5	PF12146 Hydrolase_4	0.0019	29.0	Serine aminopeptidase, S33

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420065

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290216	0.562	Secernin-2
2	9606.ENSP00000268129	0.526	Monoacylglycerol lipase ABHD2
3	9606.ENSP00000273359	0.515	Mycophenolic acid acyl-glucuronide esterase, mitochondrial
4	9606.ENSP00000414558	0.513	Protein ABHD4
5	9606.ENSP00000312814	0.511	BTB/POZ domain-containing protein KCTD2
6	9606.ENSP00000302657	0.510	Protein ABHD15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016787	1.000	hydrolase activity
GO:0005515	1.000	protein binding
GO:0016788	0.957	hydrolase activity, acting on ester bonds
GO:0052689	0.868	carboxylic ester hydrolase activity
GO:0016298	0.361	lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0044281	0.990	small molecule metabolic process
GO:0006790	0.986	sulfur compound metabolic process
GO:0006163	0.976	purine nucleotide metabolic process
GO:0080090	0.968	regulation of primary metabolic process
GO:0031323	0.962	regulation of cellular metabolic process
GO:0033865	0.960	nucleoside bisphosphate metabolic process
GO:0009889	0.952	regulation of biosynthetic process
GO:0019693	0.948	ribose phosphate metabolic process
GO:0033875	0.946	ribonucleoside bisphosphate metabolic process
GO:0034032	0.946	purine nucleoside bisphosphate metabolic process
GO:0048518	0.936	positive regulation of biological process
GO:0009150	0.932	purine ribonucleotide metabolic process
GO:0048522	0.929	positive regulation of cellular process
GO:0051171	0.914	regulation of nitrogen compound metabolic process
GO:0031326	0.911	regulation of cellular biosynthetic process
GO:0009893	0.907	positive regulation of metabolic process
GO:0006355	0.901	regulation of DNA-templated transcription
GO:0010557	0.896	positive regulation of macromolecule biosynthetic process
GO:0031328	0.893	positive regulation of cellular biosynthetic process
GO:0045893	0.858	positive regulation of DNA-templated transcription
GO:0006357	0.779	regulation of transcription by RNA polymerase II
GO:0006082	0.750	organic acid metabolic process
GO:0043436	0.743	oxoacid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005730	0.996	nucleolus
GO:0005654	0.995	nucleoplasm
GO:0005576	0.703	extracellular region
GO:0031982	0.619	vesicle
GO:0005615	0.603	extracellular space
GO:0070062	0.574	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	1.000	Hydrolases.
EC:3.1.-.-	0.957	Acting on ester bonds.
EC:3.1.1.-	0.868	Carboxylic ester hydrolases.

[back to server]