StarFunc result for job id Q96IV6

User Input

>input (333 residues)
MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFW
QAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKN
EPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTL
IEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVM
GSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTD
TMFKQTKAYERHVLLLGFTPLSESIPDSPKRME

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96IV6	1.000	1.000	1.596E-49	333	1.000	1.000	Q96IV6.pdb.gz	FXDC2_HUMAN Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FAXDC2 PE=1 SV=1
2	AFDB:Q9ZW22	0.663	0.804	2.131E-12	272	0.237	0.290	Q9ZW22.pdb.gz	SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana OX=3702 GN=SMO2-1 PE=1 SV=2
3	AFDB:Q8VWZ8	0.662	0.820	2.574E-12	266	0.228	0.286	Q8VWZ8.pdb.gz	SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana OX=3702 GN=SMO2-2 PE=1 SV=1
4	AFDB:Q15800	0.664	0.748	3.971E-11	293	0.207	0.235	Q15800.pdb.gz	MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens OX=9606 GN=MSMO1 PE=1 SV=1
5	AFDB:Q9UUH4	0.643	0.710	8.058E-11	300	0.195	0.217	Q9UUH4.pdb.gz	ERG25_SCHPO C-4 methylsterol oxidase erg25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg25 PE=2 SV=1
6	AFDB:F4JLZ6	0.662	0.753	5.319E-10	291	0.204	0.234	F4JLZ6.pdb.gz	SMO13_ARATH Methylsterol monooxygenase 1-3 OS=Arabidopsis thaliana OX=3702 GN=SMO1-3 PE=1 SV=1
7	AFDB:Q9AST3	0.587	0.746	1.574E-9	259	0.168	0.216	Q9AST3.pdb.gz	SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana OX=3702 GN=SBH2 PE=1 SV=1
8	AFDB:P53045	0.602	0.646	2.523E-9	309	0.174	0.188	P53045.pdb.gz	ERG25_YEAST C-4 methylsterol oxidase ERG25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG25 PE=1 SV=1
9	AFDB:Q5PRC0	0.604	0.786	2.645E-9	251	0.192	0.255	Q5PRC0.pdb.gz	CH25H_DANRE Cholesterol 25-hydroxylase-like protein OS=Danio rerio OX=7955 GN=ch25h PE=2 SV=1
10	AFDB:O94298	0.570	0.643	2.907E-9	293	0.168	0.191	O94298.pdb.gz	SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sur2 PE=3 SV=1
11	PDB:5oxpA	0.212	0.166	4.283E-1	462	0.123	0.089	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
12	PDB:6vrhA	0.152	0.111	2.964	541	0.072	0.044	6vrhA.pdb.gz	Chemical and structural investigation of the paroxetine-human serotonin transporter complex.
13	PDB:6gs1A	0.172	0.141	3.414	472	0.111	0.078	6gs1A.pdb.gz
14	PDB:6fmrA	0.179	0.137	3.933	475	0.108	0.076	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.
15	PDB:2mgyA	0.151	0.235	4.123	169	0.072	0.142	2mgyA.pdb.gz	Structure of the mitochondrial translocator protein in complex with a diagnostic ligand.
16	PDB:4ymkA	0.184	0.188	4.123	322	0.111	0.115	4ymkA.pdb.gz	X-ray structure of a mammalian stearoyl-CoA desaturase.
17	PDB:6oyhD	0.117	0.116	4.123	337	0.075	0.074	6oyhD.pdb.gz	Chemical logic of MraY inhibition by antibacterial nucleoside natural products.
18	PDB:4jr9A	0.092	0.079	4.531	409	0.087	0.071	4jr9A.pdb.gz	Crystal structure of a nitrate/nitrite exchanger.
19	PDB:5fn3B	0.115	0.124	4.531	286	0.126	0.147	5fn3B.pdb.gz	Sampling the conformational space of the catalytic subunit of human gamma-secretase.
20	PDB:7dv5U	0.119	0.052	4.980	1189	0.090	0.025	7dv5U.pdb.gz	Structures of human bile acid exporter ABCB11 reveal a transport mechanism facilitated by two tandem substrate-binding pockets.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96IV6	0.0	686	333	1.000	1.000	FXDC2_HUMAN Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FAXDC2 PE=1 SV=1
2	Q9ZW22	3.09e-29	115	272	0.261	0.320	SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana OX=3702 GN=SMO2-1 PE=1 SV=2
3	Q8VWZ8	1.82e-28	113	266	0.243	0.305	SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana OX=3702 GN=SMO2-2 PE=1 SV=1
4	Q15800	2.10e-21	94.4	293	0.189	0.215	MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens OX=9606 GN=MSMO1 PE=1 SV=1
5	Q8L7W5	1.21e-20	92.4	298	0.201	0.225	SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana OX=3702 GN=SMO1-1 PE=1 SV=1
6	F4JLZ6	1.92e-18	86.3	291	0.192	0.220	SMO13_ARATH Methylsterol monooxygenase 1-3 OS=Arabidopsis thaliana OX=3702 GN=SMO1-3 PE=1 SV=1
7	Q1EC69	2.61e-18	85.9	299	0.180	0.201	SMO12_ARATH Methylsterol monooxygenase 1-2 OS=Arabidopsis thaliana OX=3702 GN=SMO1-2 PE=1 SV=1
8	Q9UUH4	3.12e-17	82.8	300	0.177	0.197	ERG25_SCHPO C-4 methylsterol oxidase erg25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg25 PE=2 SV=1
9	P53045	6.08e-15	76.6	309	0.135	0.146	ERG25_YEAST C-4 methylsterol oxidase ERG25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG25 PE=1 SV=1
10	Q67WK8	1.81e-14	74.3	264	0.159	0.201	Q67WK8_ORYSJ aldehyde oxygenase (deformylating) OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0226950 PE=2 SV=1
11	Q9AST3	2.94e-11	65.1	259	0.156	0.201	SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana OX=3702 GN=SBH2 PE=1 SV=1
12	Q6FSD6	3.20e-10	62.8	340	0.195	0.191	Q6FSD6_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SUR2 PE=4 SV=1
13	A0A1D8PLB5	3.21e-10	62.8	321	0.192	0.199	A0A1D8PLB5_CANAL Erg251p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ERG251 PE=4 SV=1
14	Q8VYI1	5.79e-10	61.2	260	0.141	0.181	SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=SBH1 PE=1 SV=1
15	P38992	2.83e-09	60.1	349	0.180	0.172	SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR2 PE=1 SV=1
16	P50860	1.64e-08	57.8	364	0.135	0.124	ERG3_CANGA Delta(7)-sterol 5(6)-desaturase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ERG3 PE=3 SV=1
17	Q5PRC0	2.18e-08	56.6	251	0.183	0.243	CH25H_DANRE Cholesterol 25-hydroxylase-like protein OS=Danio rerio OX=7955 GN=ch25h PE=2 SV=1
18	O94298	3.07e-08	56.6	293	0.165	0.188	SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sur2 PE=3 SV=1
19	G8B7T4	5.94e-08	56.2	405	0.117	0.096	G8B7T4_CANPC Fatty acid hydroxylase domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=ERG3 PE=4 SV=1
20	P32353	7.29e-07	52.8	365	0.117	0.107	ERG3_YEAST Delta(7)-sterol 5(6)-desaturase ERG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19273 Exportin-5	1.2e+02	12.0	Exportin-5 family
2	PF04116 FA_hydroxylase	1.1e-17	76.1	Fatty acid hydroxylase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320604

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265896	0.921	Squalene monooxygenase
2	9606.ENSP00000341662	0.870	Alkylglycerol monooxygenase
3	9606.ENSP00000277010	0.860	Sigma non-opioid intracellular receptor 1
4	9606.ENSP00000256319	0.857	Probable ergosterol biosynthetic protein 28
5	9606.ENSP00000264027	0.843	Lathosterol oxidase
6	9606.ENSP00000380837	0.831	Lanosterol synthase
7	9606.ENSP00000480828	0.830	Squalene synthase
8	9606.ENSP00000254521	0.779	3-keto-steroid reductase
9	9606.ENSP00000355385	0.779	R3H domain containing 4
10	9606.ENSP00000359297	0.771	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
11	9606.ENSP00000411565	0.713	Dehydrogenase/reductase SDR family member 12
12	9606.ENSP00000219368	0.702	Fatty acid 2-hydroxylase
13	9606.ENSP00000379464	0.681	Zinc finger protein 134
14	9606.ENSP00000334113	0.668	Dehydrogenase/reductase SDR family member on chromosome X
15	9606.ENSP00000482704	0.664	Dehydrogenase/reductase SDR family member 11
16	9606.ENSP00000003100	0.638	Lanosterol 14-alpha demethylase
17	9606.ENSP00000244043	0.638	Prostacyclin synthase
18	9606.ENSP00000406201	0.637	Zinc finger protein 160
19	9606.ENSP00000279263	0.623	Delta(14)-sterol reductase
20	9606.ENSP00000362332	0.614	Transcription factor AP-2-epsilon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016491	0.986	oxidoreductase activity
GO:0016705	0.961	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	0.780	monooxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.977	biological regulation
GO:0050789	0.972	regulation of biological process
GO:0048518	0.929	positive regulation of biological process
GO:0050794	0.923	regulation of cellular process
GO:0071704	0.814	organic substance metabolic process
GO:0044238	0.802	primary metabolic process
GO:0019222	0.770	regulation of metabolic process
GO:0006629	0.750	lipid metabolic process
GO:0009987	0.742	cellular process
GO:0048522	0.668	positive regulation of cellular process
GO:1901576	0.634	organic substance biosynthetic process
GO:0080090	0.623	regulation of primary metabolic process
GO:0060255	0.612	regulation of macromolecule metabolic process
GO:0050793	0.605	regulation of developmental process
GO:0009893	0.604	positive regulation of metabolic process
GO:0044237	0.584	cellular metabolic process
GO:0008610	0.579	lipid biosynthetic process
GO:0031399	0.542	regulation of protein modification process
GO:1901360	0.488	organic cyclic compound metabolic process
GO:0031323	0.376	regulation of cellular metabolic process
GO:0045597	0.370	positive regulation of cell differentiation
GO:0044281	0.369	small molecule metabolic process
GO:0031401	0.359	positive regulation of protein modification process
GO:1901615	0.348	organic hydroxy compound metabolic process
GO:0051174	0.346	regulation of phosphorus metabolic process
GO:0008202	0.333	steroid metabolic process
GO:0031325	0.321	positive regulation of cellular metabolic process
GO:1901362	0.311	organic cyclic compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0016020	0.963	membrane
GO:0031090	0.939	organelle membrane
GO:0012505	0.934	endomembrane system
GO:0043231	0.920	intracellular membrane-bounded organelle
GO:0042175	0.897	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.884	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.986	Oxidoreductases.
EC:1.14.-.-	0.961	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.

[back to server]