StarFunc result for job id Q96IZ0

User Input

>input (340 residues)
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGT
PAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAA
PPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDD
EAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSR
YSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI
GKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96IZ0	0.999	0.999	4.727E-49	340	1.000	1.000	Q96IZ0.pdb.gz	PAWR_HUMAN PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1
2	AFDB:Q925B0	0.423	0.432	1.238E-34	333	0.774	0.790	Q925B0.pdb.gz	PAWR_MOUSE PRKC apoptosis WT1 regulator protein OS=Mus musculus OX=10090 GN=Pawr PE=1 SV=2
3	AFDB:Q9ZPY4	0.169	0.147	5.630E-3	397	0.162	0.139	Q9ZPY4.pdb.gz	Q9ZPY4_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g46550 PE=1 SV=1
4	AFDB:Q8GY61	0.095	0.096	9.330E-3	335	0.144	0.146	Q8GY61.pdb.gz	BH063_ARATH Transcription factor bHLH63 OS=Arabidopsis thaliana OX=3702 GN=BHLH63 PE=1 SV=1
5	AFDB:P18289	0.170	0.197	1.159E-2	289	0.144	0.170	P18289.pdb.gz	JRA_DROME Transcription factor Jra OS=Drosophila melanogaster OX=7227 GN=Jra PE=1 SV=2
6	AFDB:Q1ZXL0	0.190	0.089	2.384E-2	808	0.165	0.069	Q1ZXL0.pdb.gz	Y5795_DICDI PH domain-containing protein DDB_G0275795 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275795 PE=4 SV=1
7	AFDB:Q8L5W7	0.110	0.103	3.421E-2	363	0.112	0.105	Q8L5W7.pdb.gz	PIF6_ARATH Transcription factor PIF6 OS=Arabidopsis thaliana OX=3702 GN=PIF6 PE=1 SV=1
8	AFDB:Q5A034	0.096	0.041	4.247E-2	903	0.103	0.039	Q5A034.pdb.gz	Q5A034_CANAL DNA replication licensing factor MCM2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MCM2 PE=3 SV=1
9	AFDB:Q9FM96	0.101	0.060	6.549E-2	647	0.156	0.082	Q9FM96.pdb.gz	PSL4_ARATH Glucosidase 2 subunit beta OS=Arabidopsis thaliana OX=3702 GN=PSL4 PE=2 SV=1
10	AFDB:A0A2R8RJR5	0.121	0.128	7.039E-2	314	0.103	0.111	A0A2R8RJR5.pdb.gz
11	PDB:7d5s5J	0.082	0.160	2.415	151	0.082	0.185	7d5s5J.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
12	PDB:6bk8E	0.088	0.153	4.302	186	0.065	0.118	6bk8E.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
13	PDB:7mqaNA	0.100	0.114	5.741	295	0.074	0.085	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7w59R	0.125	0.151	6.171	280	0.103	0.125	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
15	PDB:7v2wJ	0.132	0.181	9.515	236	0.085	0.123	7v2wJ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96IZ0	0.0	679	340	1.000	1.000	PAWR_HUMAN PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1
2	Q925B0	9.97e-165	464	333	0.756	0.772	PAWR_MOUSE PRKC apoptosis WT1 regulator protein OS=Mus musculus OX=10090 GN=Pawr PE=1 SV=2
3	Q62627	2.17e-162	458	332	0.756	0.774	PAWR_RAT PRKC apoptosis WT1 regulator protein OS=Rattus norvegicus OX=10116 GN=Pawr PE=1 SV=1
4	Q5XJ95	2.59e-57	189	305	0.462	0.515	Q5XJ95_DANRE PRKC apoptosis WT1 regulator protein OS=Danio rerio OX=7955 GN=pawrl PE=2 SV=1
5	A0A1D8PN92	0.051	38.1	1948	0.079	0.014	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
6	Q96C92	0.058	37.4	435	0.088	0.069	ENTR1_HUMAN Endosome-associated-trafficking regulator 1 OS=Homo sapiens OX=9606 GN=ENTR1 PE=1 SV=3
7	P85120	0.20	36.2	2058	0.079	0.013	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
8	O70156	0.25	35.4	364	0.065	0.060	OLR1_RAT Oxidized low-density lipoprotein receptor 1 OS=Rattus norvegicus OX=10116 GN=Olr1 PE=2 SV=1
9	E9PD53	0.33	35.4	1263	0.076	0.021	E9PD53_HUMAN Structural maintenance of chromosomes protein OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=1
10	O08538	0.39	35.0	498	0.109	0.074	ANGP1_MOUSE Angiopoietin-1 OS=Mus musculus OX=10090 GN=Angpt1 PE=1 SV=2
11	Q15389	0.50	34.7	498	0.109	0.074	ANGP1_HUMAN Angiopoietin-1 OS=Homo sapiens OX=9606 GN=ANGPT1 PE=1 SV=2
12	O35460	0.63	34.3	497	0.109	0.074	ANGP1_RAT Angiopoietin-1 OS=Rattus norvegicus OX=10116 GN=Angpt1 PE=2 SV=2
13	Q0IGM5	0.78	33.9	310	0.071	0.077	Q0IGM5_ARATH At1g56080 OS=Arabidopsis thaliana OX=3702 GN=NAIP3 PE=1 SV=1
14	P97393	0.88	34.3	1503	0.068	0.015	RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus OX=10090 GN=Arhgap5 PE=1 SV=3
15	A0A0G2K7N9	0.96	33.9	1502	0.068	0.015	A0A0G2K7N9_RAT Rho GTPase activating protein 5 OS=Rattus norvegicus OX=10116 GN=Arhgap5 PE=1 SV=2
16	Q9QX27	1.0	33.9	1032	0.059	0.019	ST18_RAT Suppression of tumorigenicity 18 protein OS=Rattus norvegicus OX=10116 GN=St18 PE=2 SV=2
17	O60284	1.1	33.9	1047	0.059	0.019	ST18_HUMAN Suppression of tumorigenicity 18 protein OS=Homo sapiens OX=9606 GN=ST18 PE=1 SV=1
18	Q6TUE6	1.2	33.5	1245	0.068	0.018	Q6TUE6_RAT LRRGT00098 OS=Rattus norvegicus OX=10116 GN=Arhgap5 PE=1 SV=1
19	Q569L8	1.4	33.5	1344	0.076	0.019	CENPJ_MOUSE Centromere protein J OS=Mus musculus OX=10090 GN=Cenpj PE=2 SV=2
20	F4JTJ2	1.5	33.1	723	0.059	0.028	EREL1_ARATH PX domain-containing protein EREL1 OS=Arabidopsis thaliana OX=3702 GN=EREL1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	2.9	19.6	Autophagy protein 16 (ATG16)
2	PF20537 DUF6752	4e+02	12.2	Domain of unknown function (DUF6752)
3	PF03610 EIIA-man	4.6e+02	12.3	PTS system fructose IIA component
4	PF16046 FAM76	5e+02	11.5	FAM76 protein
5	PF08702 Fib_alpha	3.8e+02	12.6	Fibrinogen alpha/beta chain family
6	PF05911 FPP	5.4	16.8	Filament-like plant protein, long coiled-coil
7	PF14661 HAUS6_N	2.8e+02	12.5	HAUS augmin-like complex subunit 6 N-terminus
8	PF15898 PRKG1_interact	2e+02	14.1	cGMP-dependent protein kinase interacting domain
9	PF09055 Sod_Ni	2e+02	13.9	Nickel-containing superoxide dismutase
10	PF06785 UPF0242	19	16.8	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328088

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367830	0.995	Protein kinase C zeta type
2	9606.ENSP00000324173	0.989	78 kDa glucose-regulated protein
3	9606.ENSP00000331327	0.987	Wilms tumor protein
4	9606.ENSP00000330221	0.940	SPRY domain-containing SOCS box protein 1
5	9606.ENSP00000216797	0.924	NF-kappa-B inhibitor alpha
6	9606.ENSP00000384273	0.907	Transcription factor p65
7	9606.ENSP00000254250	0.904	THAP domain-containing protein 1
8	9606.ENSP00000226574	0.900	Nuclear factor NF-kappa-B p105 subunit
9	9606.ENSP00000354859	0.899	D(2) dopamine receptor
10	9606.ENSP00000442973	0.867	Death-associated protein kinase 3
11	9606.ENSP00000451828	0.799	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000418287	0.765	Probable cytosolic iron-sulfur protein assembly protein CIAO1
13	9606.ENSP00000363229	0.720	Vesicular acetylcholine transporter
14	9606.ENSP00000428338	0.692	SPRY domain-containing SOCS box protein 2
15	9606.ENSP00000389168	0.690	Protein phosphatase 1 regulatory subunit 12A
16	9606.ENSP00000308897	0.682	Mitochondrial ribosomal protein L11
17	9606.ENSP00000381007	0.660	Neuron navigator 3
18	9606.ENSP00000451594	0.659	Modulator of apoptosis 1
19	9606.ENSP00000323246	0.655	Transcription factor E2F7
20	9606.ENSP00000463325	0.654	Receptor-type tyrosine-protein phosphatase mu

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0140110	0.952	transcription regulator activity
GO:0003714	0.936	transcription corepressor activity
GO:0019904	0.897	protein domain specific binding
GO:0030275	0.853	LRR domain binding
GO:0043522	0.743	leucine zipper domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0006357	0.981	regulation of transcription by RNA polymerase II
GO:0010558	0.977	negative regulation of macromolecule biosynthetic process
GO:0031327	0.977	negative regulation of cellular biosynthetic process
GO:0045934	0.967	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.939	negative regulation of DNA-templated transcription
GO:0009987	0.897	cellular process
GO:0050896	0.870	response to stimulus
GO:0048518	0.857	positive regulation of biological process
GO:0048522	0.838	positive regulation of cellular process
GO:0000122	0.789	negative regulation of transcription by RNA polymerase II
GO:0051716	0.692	cellular response to stimulus
GO:0009893	0.582	positive regulation of metabolic process
GO:0008152	0.553	metabolic process
GO:0010604	0.523	positive regulation of macromolecule metabolic process
GO:0043067	0.487	regulation of programmed cell death
GO:0051173	0.478	positive regulation of nitrogen compound metabolic process
GO:0071704	0.476	organic substance metabolic process
GO:0031325	0.469	positive regulation of cellular metabolic process
GO:0006807	0.455	nitrogen compound metabolic process
GO:0051246	0.454	regulation of protein metabolic process
GO:0044238	0.432	primary metabolic process
GO:0007154	0.426	cell communication
GO:0042981	0.391	regulation of apoptotic process
GO:0042221	0.385	response to chemical
GO:0006950	0.379	response to stress
GO:0048583	0.374	regulation of response to stimulus
GO:0023052	0.348	signaling
GO:0043170	0.342	macromolecule metabolic process
GO:0051247	0.329	positive regulation of protein metabolic process
GO:0032501	0.313	multicellular organismal process
GO:0010557	0.309	positive regulation of macromolecule biosynthetic process
GO:1901564	0.307	organonitrogen compound metabolic process
GO:0008219	0.305	cell death
GO:0007165	0.305	signal transduction
GO:0051239	0.302	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005634	1.000	nucleus
GO:0005886	0.989	plasma membrane
GO:0005856	0.987	cytoskeleton
GO:0005829	0.941	cytosol
GO:0070013	0.930	intracellular organelle lumen
GO:0015629	0.752	actin cytoskeleton
GO:0031981	0.525	nuclear lumen
GO:0005654	0.404	nucleoplasm
GO:0032991	0.391	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]