StarFunc result for job id Q96J02

User Input

>input (903 residues)
MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNT
NSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTL
QLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLPRLECNSAISAHCNL
CLPGLSDSPISASRVAGFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNS
PSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSATSESDGSSTGSLPPTNTNTNTSEG
ATSGLIIPLTISGGSGPRPLNPVTQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPL
PPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIY
GNQDLFATSQSKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPL
PEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQ
QLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLL
SHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFS
LPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECDLEMYFSVDKEILGEIKSHDL
KPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEV
LLCGMQEIDLNDWQRHAIYRHYARTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVG
GFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGF
GQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A590UJQ1	0.652	0.654	0.000	900	0.945	0.948	A0A590UJQ1.pdb.gz	A0A590UJQ1_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
2	AFDB:A0A590UJW8	0.610	0.663	0.000	830	0.918	0.999	A0A590UJW8.pdb.gz	A0A590UJW8_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
3	AFDB:A0A590UK44	0.560	0.646	0.000	779	0.860	0.997	A0A590UK44.pdb.gz	A0A590UK44_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
4	AFDB:O00308	0.521	0.541	0.000	870	0.560	0.582	O00308.pdb.gz	WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2 PE=1 SV=2
5	AFDB:Q96J02	1.000	1.000	0.000	903	1.000	1.000	Q96J02.pdb.gz	ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=2
6	AFDB:Q9H0M0	0.634	0.623	0.000	922	0.600	0.588	Q9H0M0.pdb.gz	WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1 PE=1 SV=1
7	AFDB:U6C7R6	0.647	0.673	0.000	867	0.744	0.775	U6C7R6.pdb.gz	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1
8	AFDB:K7WBL1	0.542	0.571	5.165E-101	856	0.493	0.520	K7WBL1.pdb.gz	K7WBL1_9CRUS E3 ubiquitin-protein ligase OS=Artemia sinica OX=112780 PE=2 SV=1
9	AFDB:Q9N2Z7	0.606	0.682	2.583E-96	794	0.471	0.535	Q9N2Z7.pdb.gz	WWP1_CAEEL E3 ubiquitin-protein ligase wwp-1 OS=Caenorhabditis elegans OX=6239 GN=wwp-1 PE=1 SV=2
10	AFDB:Q9UTG2	0.280	0.373	2.597E-53	671	0.271	0.365	Q9UTG2.pdb.gz	PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub2 PE=1 SV=1
11	PDB:7jq9A	0.388	0.146	2.892E-35	2427	0.166	0.062	7jq9A.pdb.gz
12	PDB:7mopA	0.379	0.142	1.409E-34	2445	0.165	0.061	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:5a50A	0.121	0.592	4.046E-10	165	0.032	0.176	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
14	PDB:4rj9A	0.119	0.588	5.972E-9	161	0.033	0.186	4rj9A.pdb.gz
15	PDB:5a52A	0.121	0.636	6.295E-9	154	0.032	0.188	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:1cjyA	0.118	0.165	6.636E-9	633	0.025	0.036	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
17	PDB:5ixcA	0.118	0.154	1.628E-8	684	0.022	0.029	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
18	PDB:5iz5B	0.124	0.149	2.355E-8	746	0.023	0.028	5iz5B.pdb.gz
19	PDB:5izrC	0.114	0.154	2.355E-8	659	0.022	0.030	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
20	PDB:3nsjA	0.114	0.191	1.750E-7	530	0.025	0.043	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A590UJQ1	0.0	1751	900	0.952	0.956	A0A590UJQ1_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
2	A0A590UJW8	0.0	1686	830	0.918	0.999	A0A590UJW8_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
3	A0A590UK44	0.0	1137	779	0.691	0.801	A0A590UK44_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
4	A2VCZ7	0.0	959	866	0.559	0.583	A2VCZ7_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=id:ibd1121 PE=1 SV=1
5	F6P346	0.0	968	867	0.557	0.580	F6P346_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=id:ibd1121 PE=1 SV=1
6	K7WBL1	0.0	905	856	0.502	0.529	K7WBL1_9CRUS E3 ubiquitin-protein ligase OS=Artemia sinica OX=112780 PE=2 SV=1
7	O00308	0.0	973	870	0.573	0.594	WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2 PE=1 SV=2
8	P39940	0.0	567	809	0.313	0.350	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
9	Q8BZZ3	0.0	1087	918	0.615	0.605	WWP1_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus musculus OX=10090 GN=Wwp1 PE=1 SV=2
10	Q8C863	0.0	1640	864	0.915	0.956	ITCH_MOUSE E3 ubiquitin-protein ligase Itchy OS=Mus musculus OX=10090 GN=Itch PE=1 SV=2
11	Q92462	0.0	579	767	0.318	0.374	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
12	Q96J02	0.0	1882	903	1.000	1.000	ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=2
13	Q9DBH0	0.0	986	870	0.574	0.595	WWP2_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus OX=10090 GN=Wwp2 PE=1 SV=1
14	Q9H0M0	0.0	1058	922	0.616	0.603	WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1 PE=1 SV=1
15	Q9N2Z7	0.0	807	794	0.415	0.472	WWP1_CAEEL E3 ubiquitin-protein ligase wwp-1 OS=Caenorhabditis elegans OX=6239 GN=wwp-1 PE=1 SV=2
16	Q9Y0H4	0.0	890	949	0.518	0.493	SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster OX=7227 GN=Su(dx) PE=1 SV=1
17	U6C7R6	0.0	1329	867	0.735	0.766	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1
18	Q5BDP1	3.05e-180	543	821	0.315	0.346	RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hulA PE=1 SV=1
19	O14326	4.48e-177	533	786	0.301	0.346	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
20	D7NIW0	1.92e-172	528	968	0.306	0.285	D7NIW0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.6e-11	55.1	C2 domain
2	PF00632 HECT	8.2e-90	312.9	HECT-domain (ubiquitin-transferase)
3	PF00397 WW	8.4e-40	145.8	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480499

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386884	0.993	C-X-C chemokine receptor type 4
2	9606.ENSP00000451300	0.992	Protein numb homolog
3	9606.ENSP00000409581	0.991	Beta-arrestin-1
4	9606.ENSP00000242719	0.989	RING finger protein 11
5	9606.ENSP00000264731	0.989	Tumor protein 63
6	9606.ENSP00000400906	0.988	Ubiquitin-conjugating enzyme E2L 3
7	9606.ENSP00000367545	0.987	Tumor protein p73
8	9606.ENSP00000342235	0.985	Receptor tyrosine-protein kinase erbB-4
9	9606.ENSP00000312455	0.984	CASP8 and FADD-like apoptosis regulator
10	9606.ENSP00000277541	0.978	Neurogenic locus notch homolog protein 1
11	9606.ENSP00000462521	0.976	Thioredoxin-interacting protein
12	9606.ENSP00000331201	0.971	Hepatocyte growth factor-regulated tyrosine kinase substrate
13	9606.ENSP00000352438	0.971	Poly(rC)-binding protein 2
14	9606.ENSP00000441543	0.964	Polyubiquitin-C
15	9606.ENSP00000364893	0.963	Rho guanine nucleotide exchange factor 7
16	9606.ENSP00000433623	0.941	TNF receptor-associated factor 6
17	9606.ENSP00000381717	0.940	Ubiquitin-conjugating enzyme E2 D2
18	9606.ENSP00000478927	0.939	Transcriptional coactivator YAP1
19	9606.ENSP00000220751	0.938	Receptor-interacting serine/threonine-protein kinase 2
20	9606.ENSP00000357879	0.938	26S proteasome non-ATPase regulatory subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0016874	0.989	ligase activity
GO:0061630	0.972	ubiquitin protein ligase activity
GO:0019899	0.913	enzyme binding
GO:0005102	0.759	signaling receptor binding
GO:0044389	0.593	ubiquitin-like protein ligase binding
GO:0005126	0.573	cytokine receptor binding
GO:0044877	0.523	protein-containing complex binding
GO:0001664	0.441	G protein-coupled receptor binding
GO:0042379	0.401	chemokine receptor binding
GO:0043021	0.398	ribonucleoprotein complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0009987	0.990	cellular process
GO:0044238	0.990	primary metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0048519	0.984	negative regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0043170	0.977	macromolecule metabolic process
GO:0019538	0.958	protein metabolic process
GO:0048518	0.948	positive regulation of biological process
GO:0051171	0.924	regulation of nitrogen compound metabolic process
GO:0043412	0.909	macromolecule modification
GO:0048583	0.906	regulation of response to stimulus
GO:0070647	0.898	protein modification by small protein conjugation or removal
GO:0044237	0.894	cellular metabolic process
GO:0016567	0.872	protein ubiquitination
GO:0050896	0.871	response to stimulus
GO:0080090	0.865	regulation of primary metabolic process
GO:0048523	0.842	negative regulation of cellular process
GO:0006508	0.829	proteolysis
GO:0000209	0.804	protein polyubiquitination
GO:0010468	0.784	regulation of gene expression
GO:0051716	0.773	cellular response to stimulus
GO:0032501	0.759	multicellular organismal process
GO:0002682	0.726	regulation of immune system process
GO:0010605	0.726	negative regulation of macromolecule metabolic process
GO:0048585	0.684	negative regulation of response to stimulus
GO:0009966	0.676	regulation of signal transduction
GO:0048522	0.670	positive regulation of cellular process
GO:0080134	0.668	regulation of response to stress
GO:0032101	0.627	regulation of response to external stimulus
GO:0009894	0.624	regulation of catabolic process
GO:0031347	0.624	regulation of defense response
GO:0002831	0.623	regulation of response to biotic stimulus
GO:0007154	0.620	cell communication
GO:0023052	0.618	signaling
GO:0009893	0.616	positive regulation of metabolic process
GO:0007165	0.614	signal transduction
GO:0009057	0.591	macromolecule catabolic process
GO:1901565	0.568	organonitrogen compound catabolic process
GO:0070936	0.562	protein K48-linked ubiquitination
GO:0019941	0.545	modification-dependent protein catabolic process
GO:0051173	0.533	positive regulation of nitrogen compound metabolic process
GO:0051246	0.532	regulation of protein metabolic process
GO:0065009	0.530	regulation of molecular function
GO:0048584	0.529	positive regulation of response to stimulus
GO:0051239	0.515	regulation of multicellular organismal process
GO:0010604	0.508	positive regulation of macromolecule metabolic process
GO:0031323	0.493	regulation of cellular metabolic process
GO:0002376	0.473	immune system process
GO:0010556	0.451	regulation of macromolecule biosynthetic process
GO:0031326	0.451	regulation of cellular biosynthetic process
GO:0051252	0.450	regulation of RNA metabolic process
GO:0050688	0.448	regulation of defense response to virus
GO:0006355	0.443	regulation of DNA-templated transcription
GO:0002832	0.425	negative regulation of response to biotic stimulus
GO:0031348	0.409	negative regulation of defense response
GO:0050776	0.389	regulation of immune response
GO:0006511	0.360	ubiquitin-dependent protein catabolic process
GO:1902531	0.334	regulation of intracellular signal transduction
GO:0032502	0.333	developmental process
GO:0031325	0.320	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.979	cytosol
GO:0032991	0.941	protein-containing complex
GO:0071944	0.903	cell periphery
GO:0016020	0.882	membrane
GO:0031982	0.873	vesicle
GO:0005576	0.803	extracellular region
GO:0005615	0.636	extracellular space
GO:0065010	0.572	extracellular membrane-bounded organelle
GO:0070062	0.548	extracellular exosome
GO:0097708	0.384	intracellular vesicle
GO:0031410	0.372	cytoplasmic vesicle
GO:0012505	0.314	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:6.-.-.-	0.989	Ligases.

[back to server]