StarFunc result for job id Q96J42

User Input

>input (360 residues)
MVPAAGRRPPRVMRLLGWWQVLLWVLGLPVRGVEVAEESGRLWSEEQPAHPLQVGAVYLG
EEELLHDPMGQDRAAEEANAVLGLDTQGDHMVMLSVIPGEAEDKVSSEPSGVTCGAGGAE
DSRCNVRESLFSLDGAGAHFPDREEEYYTEPEVAESDAAPTEDSNNTESLKSPKVNCEER
NITGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPWCRFSASLAPHFNSLPRAFPAL
HFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAK
KNVVVTQADQIGPLPSTLIKSVDWLLVFSLFFLISFIMYATIRTESIRWLIPGQEQEHVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96J42	1.000	1.000	9.514E-65	360	1.000	1.000	Q96J42.pdb.gz	TXD15_HUMAN Thioredoxin domain-containing protein 15 OS=Homo sapiens OX=9606 GN=TXNDC15 PE=1 SV=1
2	AFDB:Q6P6J9	0.661	0.688	1.336E-51	344	0.772	0.808	Q6P6J9.pdb.gz	TXD15_MOUSE Thioredoxin domain-containing protein 15 OS=Mus musculus OX=10090 GN=Txndc15 PE=1 SV=1
3	AFDB:F1Q6E6	0.540	0.670	6.827E-33	286	0.392	0.493	F1Q6E6.pdb.gz
4	AFDB:O64654	0.286	0.368	7.956E-7	275	0.117	0.153	O64654.pdb.gz	TRL11_ARATH Thioredoxin-like 1-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g08570 PE=2 SV=1
5	PDB:5gu6A	0.256	0.245	9.068E-7	377	0.086	0.082	5gu6A.pdb.gz
6	AFDB:Q6P902	0.276	0.196	1.750E-6	515	0.125	0.087	Q6P902.pdb.gz	TXND2_MOUSE Thioredoxin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Txndc2 PE=1 SV=1
7	PDB:3f8uA	0.245	0.190	1.994E-6	469	0.047	0.036	3f8uA.pdb.gz
8	PDB:2r2jA	0.246	0.268	2.129E-6	328	0.083	0.091	2r2jA.pdb.gz
9	PDB:4j56E	0.270	0.865	2.769E-6	105	0.047	0.162	4j56E.pdb.gz	Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
10	PDB:3f3qA	0.262	0.814	3.845E-6	109	0.056	0.183	3f3qA.pdb.gz	Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
11	AFDB:Q8LCT3	0.274	0.407	9.648E-6	236	0.094	0.144	Q8LCT3.pdb.gz	TRL22_ARATH Thioredoxin-like 2-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g29670 PE=2 SV=2
12	PDB:2fa4A	0.257	0.825	1.174E-5	104	0.050	0.173	2fa4A.pdb.gz
13	PDB:3qouA	0.263	0.332	1.254E-5	282	0.064	0.082	3qouA.pdb.gz	Escherichia coli Thioredoxin-like Protein YbbN Contains an Atypical Tetratricopeptide Repeat Motif and Is a Negative Regulator of GroEL.
14	PDB:4pufC	0.264	0.793	1.430E-5	112	0.056	0.179	4pufC.pdb.gz
15	PDB:3apoA	0.239	0.130	1.741E-5	688	0.061	0.032	3apoA.pdb.gz
16	PDB:2l4qA	0.250	0.715	1.859E-5	116	0.056	0.172	2l4qA.pdb.gz
17	AFDB:P28906	0.130	0.126	2.086E-1	385	0.117	0.109	P28906.pdb.gz	CD34_HUMAN Hematopoietic progenitor cell antigen CD34 OS=Homo sapiens OX=9606 GN=CD34 PE=1 SV=2
18	AFDB:D3J0E7	0.077	0.038	1.496	919	0.094	0.037	D3J0E7.pdb.gz	D3J0E7_DANRE protein xylosyltransferase OS=Danio rerio OX=7955 GN=xylt1 PE=2 SV=1
19	AFDB:Q9MAH1	0.263	0.140	1.945	699	0.042	0.021	Q9MAH1.pdb.gz	TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana OX=3702 GN=TTL1 PE=1 SV=1
20	AFDB:A0A0G2JX78	0.086	0.060	2.077	632	0.094	0.054	A0A0G2JX78.pdb.gz	A0A0G2JX78_RAT 5'-nucleotidase, cytosolic IB OS=Rattus norvegicus OX=10116 GN=Nt5c1b PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P6J9	0.0	551	344	0.772	0.808	TXD15_MOUSE Thioredoxin domain-containing protein 15 OS=Mus musculus OX=10090 GN=Txndc15 PE=1 SV=1
2	Q96J42	0.0	743	360	1.000	1.000	TXD15_HUMAN Thioredoxin domain-containing protein 15 OS=Homo sapiens OX=9606 GN=TXNDC15 PE=1 SV=1
3	Q9BS26	2.37e-07	54.7	406	0.086	0.076	ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1
4	Q00216	2.39e-07	54.3	359	0.081	0.081	TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger OX=5061 GN=tigA PE=2 SV=1
5	Q9D1Q6	4.84e-07	53.5	406	0.083	0.074	ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus OX=10090 GN=Erp44 PE=1 SV=1
6	Q6P3G9	5.91e-07	53.1	408	0.089	0.078	Q6P3G9_DANRE Endoplasmic reticulum protein 44 OS=Danio rerio OX=7955 GN=txndc4 PE=1 SV=1
7	P08003	6.69e-07	53.5	638	0.097	0.055	PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus OX=10090 GN=Pdia4 PE=1 SV=3
8	Q17967	9.26e-07	52.8	485	0.067	0.049	PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans OX=6239 GN=pdi-1 PE=3 SV=1
9	P38659	2.19e-06	52.0	643	0.089	0.050	PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2
10	Q86UY0	2.62e-06	51.2	360	0.072	0.072	Q86UY0_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=1
11	Q17770	2.83e-06	51.2	493	0.069	0.051	PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans OX=6239 GN=pdi-2 PE=1 SV=1
12	Q91W90	4.61e-06	50.4	417	0.111	0.096	TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus OX=10090 GN=Txndc5 PE=1 SV=2
13	Q8NBS9	6.11e-06	50.1	432	0.072	0.060	TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2
14	O22263	7.46e-06	49.7	361	0.103	0.102	PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-1 PE=2 SV=1
15	P13667	7.92e-06	50.1	645	0.086	0.048	PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2
16	Q9VYV3	1.26e-05	49.3	416	0.081	0.070	TXND5_DROME Thioredoxin domain-containing protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=prtp PE=1 SV=2
17	Q582J4	4.87e-05	45.1	135	0.072	0.193	Q582J4_TRYB2 Protein disulfide isomerase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.170 PE=3 SV=1
18	Q9MAU6	6.29e-05	47.0	447	0.078	0.063	PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-2 PE=2 SV=2
19	Q9V438	7.63e-05	46.6	433	0.064	0.053	PDIA6_DROME Protein disulfide-isomerase A6 homolog OS=Drosophila melanogaster OX=7227 GN=CaBP1 PE=1 SV=1
20	Q86IA3	8.92e-05	46.2	363	0.081	0.080	PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum OX=44689 GN=pdi1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00085 Thioredoxin	3.4e-05	35.1	Thioredoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429367	0.721	Protein FAM92A
2	9606.ENSP00000377690	0.715	Participates positively in the ciliary Hedgehog (Hh) signaling
3	9606.ENSP00000370460	0.648	Peptidyl-prolyl cis-trans isomerase CWC27 homolog
4	9606.ENSP00000421544	0.640	Pterin-4-alpha-carbinolamine dehydratase 2
5	9606.ENSP00000416534	0.633	Probable ATP-dependent RNA helicase DDX46
6	9606.ENSP00000413049	0.631	Solute carrier family 25 member 48
7	9606.ENSP00000484804	0.630	LisH domain-containing protein ARMC9
8	9606.ENSP00000381064	0.621	Integrator complex subunit 10
9	9606.ENSP00000263083	0.620	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1
10	9606.ENSP00000297156	0.617	Calcium signal-modulating cyclophilin ligand
11	9606.ENSP00000376141	0.611	Major facilitator superfamily domain containing 6
12	9606.ENSP00000252530	0.608	Protein FAM98C
13	9606.ENSP00000233027	0.607	Serine/threonine-protein kinase Nek4
14	9606.ENSP00000274140	0.590	E3 ubiquitin-protein ligase MARCH6
15	9606.ENSP00000310260	0.567	Integrator complex subunit 6
16	9606.ENSP00000432695	0.565	Probable tRNA methyltransferase 9-like protein
17	9606.ENSP00000181839	0.556	Cyclin-dependent kinase 13
18	9606.ENSP00000274507	0.515	Leukocyte cell-derived chemotaxin-2
19	9606.ENSP00000311273	0.512	Dynein heavy chain 7, axonemal
20	9606.ENSP00000295682	0.504	Keratinocyte-associated protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.922	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0060271	0.935	cilium assembly
GO:0008589	0.844	regulation of smoothened signaling pathway
GO:0009967	0.821	positive regulation of signal transduction
GO:0045880	0.604	positive regulation of smoothened signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005929	0.979	cilium
GO:0043229	0.963	intracellular organelle
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0005737	0.911	cytoplasm
GO:0016020	0.707	membrane
GO:0005634	0.625	nucleus
GO:0012505	0.392	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]