StarFunc result for job id Q96J65

User Input

>input (1359 residues)
MVGEGPYLISDLDQRGRRRSFAERYDPSLKTMIPVRPCARLAPNPVDDAGLLSFATFSWL
TPVMVKGYRQRLTVDTLPPLSTYDSSDTNAKRFRVLWDEEVARVGPEKASLSHVVWKFQR
TRVLMDIVANILCIIMAAIGPVILIHQILQQTERTSGKVWVGIGLCIALFATEFTKVFFW
ALAWAINYRTAIRLKVALSTLVFENLVSFKTLTHISVGEVLNILSSDSYSLFEAALFCPL
PATIPILMVFCAAYAFFILGPTALIGISVYVIFIPVQMFMAKLNSAFRRSAILVTDKRVQ
TMNEFLTCIRLIKMYAWEKSFTNTIQDIRRRERKLLEKAGFVQSGNSALAPIVSTIAIVL
TLSCHILLRRKLTAPVAFSVIAMFNVMKFSIAILPFSIKAMAEANVSLRRMKKILIDKSP
PSYITQPEDPDTVLLLANATLTWEHEASRKSTPKKLQNQKRHLCKKQRSEAYSERSPPAK
GATGPEEQSDSLKSVLHSISFVVRKGKILGICGNVGSGKSSLLAALLGQMQLQKGVVAVN
GTLAYVSQQAWIFHGNVRENILFGEKYDHQRYQHTVRVCGLQKDLSNLPYGDLTEIGERG
LNLSGGQRQRISLARAVYSDRQLYLLDDPLSAVDAHVGKHVFEECIKKTLRGKTVVLVTH
QLQFLESCDEVILLEDGEICEKGTHKELMEERGRYAKLIHNLRGLQFKDPEHLYNAAMVE
AFKESPAEREEDAGIIVLAPGNEKDEGKESETGSEFVDTKVPEHQLIQTESPQEGTVTWK
TYHTYIKASGGYLLSLFTVFLFLLMIGSAAFSNWWLGLWLDKGSRMTCGPQGNRTMCEVG
AVLADIGQHVYQWVYTASMVFMLVFGVTKGFVFTKTTLMASSSLHDTVFDKILKSPMSFF
DTTPTGRLMNRFSKDMDELDVRLPFHAENFLQQFFMVVFILVILAAVFPAVLLVVASLAV
GFFILLRIFHRGVQELKKVENVSRSPWFTHITSSMQGLGIIHAYGKKESCITYHLLYFNC
ALRWFALRMDVLMNILTFTVALLVTLSFSSISTSSKGLSLSYIIQLSGLLQVCVRTGTET
QAKFTSVELLREYISTCVPECTHPLKVGTCPKDWPSRGEITFRDYQMRYRDNTPLVLDSL
NLNIQSGQTVGIVGRTGSGKSSLGMALFRLVEPASGTIFIDEVDICILSLEDLRTKLTVI
PQDPVLFVGTVRYNLDPFESHTDEMLWQVLERTFMRDTIMKLPEKLQAEVTENGENFSVG
ERQLLCVARALLRNSKIILLDEATASMDSKTDTLVQNTIKDAFKGCTVLTIAHRLNTVLN
CDHVLVMENGKVIEFDKPEVLAEKPDSAFAMLLAAEVRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EYG0	0.862	0.823	0.000	1426	0.444	0.424	E7EYG0.pdb.gz	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
2	AFDB:O15440	0.901	0.853	0.000	1437	0.451	0.427	O15440.pdb.gz	MRP5_HUMAN ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2
3	AFDB:Q80WJ6	0.955	0.950	0.000	1366	0.852	0.848	Q80WJ6.pdb.gz	MRP9_MOUSE ATP-binding cassette sub-family C member 12 OS=Mus musculus OX=10090 GN=Abcc12 PE=1 SV=1
4	AFDB:Q96J65	1.000	1.000	0.000	1359	1.000	1.000	Q96J65.pdb.gz	MRP9_HUMAN ATP-binding cassette sub-family C member 12 OS=Homo sapiens OX=9606 GN=ABCC12 PE=1 SV=2
5	AFDB:Q96J66	0.892	0.877	0.000	1382	0.480	0.472	Q96J66.pdb.gz	MRP8_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens OX=9606 GN=ABCC11 PE=1 SV=1
6	AFDB:G5EE72	0.853	0.815	1.046E-101	1427	0.349	0.332	G5EE72.pdb.gz	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
7	AFDB:P33527	0.829	0.739	1.238E-94	1531	0.332	0.295	P33527.pdb.gz	MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3
8	AFDB:A0A0R4IC81	0.833	0.749	1.824E-94	1518	0.318	0.285	A0A0R4IC81.pdb.gz	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
9	AFDB:O15438	0.799	0.716	2.362E-94	1527	0.311	0.277	O15438.pdb.gz	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
10	AFDB:Q54P13	0.796	0.686	3.334E-94	1593	0.312	0.266	Q54P13.pdb.gz	ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum OX=44689 GN=abcC8 PE=3 SV=1
11	PDB:7mpeA	0.650	0.624	1.015E-74	1428	0.294	0.280	7mpeA.pdb.gz
12	PDB:7vluA	0.781	0.911	2.111E-74	1159	0.260	0.305	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
13	PDB:7s5xE	0.792	0.763	2.313E-72	1412	0.274	0.264	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
14	PDB:6jb1B	0.715	0.712	2.269E-71	1366	0.270	0.269	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
15	PDB:5ykfB	0.715	0.740	2.226E-70	1309	0.273	0.283	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
16	PDB:6c3pE	0.786	0.786	8.672E-69	1359	0.272	0.272	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
17	PDB:6msmA	0.767	0.875	4.111E-66	1181	0.242	0.279	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
18	PDB:6c3oE	0.748	0.786	4.292E-66	1290	0.269	0.284	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
19	PDB:5w81A	0.763	0.877	2.464E-64	1173	0.256	0.297	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.
20	PDB:5uakA	0.675	0.788	9.880E-60	1139	0.233	0.277	5uakA.pdb.gz	Molecular Structure of the Human CFTR Ion Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	721	1215	0.315	0.352	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	681	1408	0.328	0.317	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	590	1557	0.294	0.256	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	734	1518	0.333	0.298	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	667	1492	0.321	0.292	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1U8QTJ9	619	1396	0.274	0.267	CICA_EMENI ABC-type transporter cicA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicA PE=1 SV=1
7	A7KVC2	612	1510	0.316	0.285	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
8	B2RX12	697	1523	0.322	0.287	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
9	E1B2R7	1173	1426	0.444	0.423	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
10	E7EYG0	1183	1426	0.446	0.425	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
11	E7F118	715	1507	0.339	0.306	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
12	E9Q236	771	1325	0.341	0.349	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
13	F1LR52	743	1288	0.307	0.324	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
14	F1M3J4	763	1325	0.333	0.342	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
15	G5EE72	834	1427	0.349	0.332	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
16	G5EFP3	637	1573	0.317	0.274	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
17	I3L4X2	739	1440	0.337	0.318	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
18	O15438	679	1527	0.327	0.291	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
19	O15439	768	1325	0.341	0.349	MRP4_HUMAN ATP-binding cassette sub-family C member 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3
20	O15440	1181	1437	0.451	0.427	MRP5_HUMAN ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	0.41	22.5	AAA ATPase domain
2	PF13238 AAA_18	1.3e+02	14.5	AAA domain
3	PF13304 AAA_21	0.38	22.1	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	2.5	19.8	AAA domain
5	PF13476 AAA_23	2	20.4	AAA domain
6	PF13555 AAA_29	0.17	23.0	P-loop containing region of AAA domain
7	PF12775 AAA_7	2.7e+02	12.5	P-loop containing dynein motor region
8	PF00664 ABC_membrane	2.2e-42	157.2	ABC transporter transmembrane region
9	PF00005 ABC_tran	8.9e-48	173.7	ABC transporter
10	PF00006 ATP-synt_ab	68	14.6	ATP synthase alpha/beta family, nucleotide-binding domain
11	PF19993 DO-GTPase2	3.7e+02	12.2	Double-GTPase 2
12	PF01935 DUF87	74	14.9	Helicase HerA, central domain
13	PF00350 Dynamin_N	4.4	18.8	Dynamin family
14	PF01580 FtsK_SpoIIIE	2.1e+02	12.7	FtsK/SpoIIIE family
15	PF07693 KAP_NTPase	5e+02	11.3	KAP family P-loop domain
16	PF03308 MeaB	4e+02	11.4	Methylmalonyl Co-A mutase-associated GTPase MeaB
17	PF01926 MMR_HSR1	0.54	21.8	50S ribosome-binding GTPase
18	PF00931 NB-ARC	2.2e+02	12.4	NB-ARC domain
19	PF08423 Rad51	4.8e+02	11.4	Rad51
20	PF03193 RsgA_GTPase	0.062	24.7	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245539	0.792	Mitochondrial ribosomal protein S7
2	9606.ENSP00000344403	0.708	Plays a role in spermatogenesis.
3	9606.ENSP00000262225	0.617	Transmembrane emp24 domain-containing protein 2
4	9606.ENSP00000222388	0.614	ATP binding cassette subfamily F member 2
5	9606.ENSP00000334474	0.605	Zinc finger MIZ domain-containing protein 1
6	9606.ENSP00000413405	0.541	GPI mannosyltransferase 4
7	9606.ENSP00000333735	0.500	Nuclear pore-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140359	0.996	ABC-type transporter activity
GO:0005488	0.991	binding
GO:0005515	0.964	protein binding
GO:0015318	0.894	inorganic molecular entity transmembrane transporter activity
GO:1901363	0.817	heterocyclic compound binding
GO:0097159	0.799	organic cyclic compound binding
GO:0008514	0.656	organic anion transmembrane transporter activity
GO:1901682	0.644	sulfur compound transmembrane transporter activity
GO:0008559	0.620	ABC-type xenobiotic transporter activity
GO:0015103	0.563	inorganic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071702	0.990	organic substance transport
GO:0071705	0.934	nitrogen compound transport
GO:0009987	0.920	cellular process
GO:0000041	0.771	transition metal ion transport
GO:0050896	0.615	response to stimulus
GO:0008152	0.583	metabolic process
GO:0055085	0.527	transmembrane transport
GO:0071704	0.459	organic substance metabolic process
GO:0042221	0.383	response to chemical
GO:0065007	0.382	biological regulation
GO:0006807	0.342	nitrogen compound metabolic process
GO:0050789	0.340	regulation of biological process
GO:0015711	0.332	organic anion transport
GO:0032501	0.326	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005737	0.997	cytoplasm
GO:0016020	0.992	membrane
GO:0012505	0.981	endomembrane system
GO:0071944	0.946	cell periphery
GO:0005886	0.927	plasma membrane
GO:0031982	0.592	vesicle
GO:0005739	0.543	mitochondrion
GO:0045178	0.382	basal part of cell
GO:0098590	0.375	plasma membrane region
GO:0009925	0.342	basal plasma membrane
GO:0005783	0.324	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.996	Translocases.
EC:7.6.2.2	0.620	ABC-type xenobiotic transporter.

[back to server]