StarFunc result for job id Q96J66

User Input

>input (1382 residues)
MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWSQQERNPEAPGRAAVPP
WGKYDAALRTMIPFRPKPRFPAPQPLDNAGLFSYLTVSWLTPLMIQSLRSRLDENTIPPL
SVHDASDKNVQRLHRLWEEEVSRRGIEKASVLLVMLRFQRTRLIFDALLGICFCIASVLG
PILIIPKILEYSEEQLGNVVHGVGLCFALFLSECVKSLSFSSSWIINQRTAIRFRAAVSS
FAFEKLIQFKSVIHITSGEAISFFTGDVNYLFEGVCYGPLVLITCASLVICSISSYFIIG
YTAFIAILCYLLVFPLAVFMTRMAVKAQHHTSEVSDQRIRVTSEVLTCIKLIKMYTWEKP
FAKIIEDLRRKERKLLEKCGLVQSLTSITLFIIPTVATAVWVLIHTSLKLKLTASMAFSM
LASLNLLRLSVFFVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEAT
LSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSKGMML
GVCGNTGSGKSSLLSAILEEMHLLEGSVGVQGSLAYVPQQAWIVSGNIRENILMGGAYDK
ARYLQVLHCCSLNRDLELLPFGDMTEIGERGLNLSGGQKQRISLARAVYSDRQIYLLDDP
LSAVDAHVGKHIFEECIKKTLRGKTVVLVTHQLQYLEFCGQIILLENGKICENGTHSELM
QKKGKYAQLIQKMHKEATSDMLQDTAKIAEKPKVESQALATSLEESLNGNAVPEHQLTQE
EEMEEGSLSWRVYHHYIQAAGGYMVSCIIFFFVVLIVFLTIFSFWWLSYWLEQGSGTNSS
RESNGTMADLGNIADNPQLSFYQLVYGLNALLLICVGVCSSGIFTKVTRKASTALHNKLF
NKVFRCPMSFFDTIPIGRLLNCFAGDLEQLDQLLPIFSEQFLVLSLMVIAVLLIVSVLSP
YILLMGAIIMVICFIYYMMFKKAIGVFKRLENYSRSPLFSHILNSLQGLSSIHVYGKTED
FISQFKRLTDAQNNYLLLFLSSTRWMALRLEIMTNLVTLAVALFVAFGISSTPYSFKVMA
VNIVLQLASSFQATARIGLETEAQFTAVERILQYMKMCVSEAPLHMEGTSCPQGWPQHGE
IIFQDYHMKYRDNTPTVLHGINLTIRGHEVVGIVGRTGSGKSSLGMALFRLVEPMAGRIL
IDGVDICSIGLEDLRSKLSVIPQDPVLLSGTIRFNLDPFDRHTDQQIWDALERTFLTKAI
SKFPKKLHTDVVENGGNFSVGERQLLCIARAVLRNSKIILIDEATASIDMETDTLIQRTI
REAFQGCTVLVIAHRVTTVLNCDHILVMGNGKVVEFDRPEVLRKKPGSLFAALMATATSS
LR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EYG0	0.865	0.839	0.000	1426	0.395	0.383	E7EYG0.pdb.gz	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
2	AFDB:O15440	0.876	0.843	0.000	1437	0.407	0.392	O15440.pdb.gz	MRP5_HUMAN ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2
3	AFDB:Q80WJ6	0.860	0.870	0.000	1366	0.465	0.471	Q80WJ6.pdb.gz	MRP9_MOUSE ATP-binding cassette sub-family C member 12 OS=Mus musculus OX=10090 GN=Abcc12 PE=1 SV=1
4	AFDB:Q96J65	0.881	0.895	0.000	1359	0.474	0.482	Q96J65.pdb.gz	MRP9_HUMAN ATP-binding cassette sub-family C member 12 OS=Homo sapiens OX=9606 GN=ABCC12 PE=1 SV=2
5	AFDB:Q96J66	1.000	1.000	0.000	1382	1.000	1.000	Q96J66.pdb.gz	MRP8_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens OX=9606 GN=ABCC11 PE=1 SV=1
6	AFDB:G5EE72	0.843	0.817	1.306E-95	1427	0.308	0.298	G5EE72.pdb.gz	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
7	AFDB:A0A2R8Q6E0	0.814	0.846	3.137E-95	1327	0.318	0.331	A0A2R8Q6E0.pdb.gz
8	AFDB:A7KVC2	0.842	0.773	1.024E-94	1510	0.300	0.274	A7KVC2.pdb.gz	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
9	AFDB:E9Q236	0.815	0.849	2.255E-94	1325	0.312	0.325	E9Q236.pdb.gz	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
10	AFDB:Q9LK62	0.853	0.791	3.495E-94	1493	0.298	0.276	Q9LK62.pdb.gz	AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana OX=3702 GN=ABCC7 PE=1 SV=1
11	PDB:7mpeA	0.665	0.646	1.927E-77	1428	0.292	0.283	7mpeA.pdb.gz
12	PDB:7vluA	0.765	0.905	6.005E-75	1159	0.266	0.318	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
13	PDB:7s5xE	0.782	0.766	1.679E-73	1412	0.271	0.265	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
14	PDB:6jb1B	0.726	0.734	1.287E-71	1366	0.270	0.273	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
15	PDB:5ykfB	0.720	0.757	1.405E-71	1309	0.266	0.281	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
16	PDB:6c3pE	0.765	0.777	2.960E-71	1359	0.256	0.260	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
17	PDB:6msmA	0.730	0.846	8.828E-69	1181	0.247	0.290	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
18	PDB:6c3oE	0.725	0.774	1.148E-68	1290	0.260	0.278	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
19	PDB:5w81A	0.739	0.862	9.578E-65	1173	0.243	0.286	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.
20	PDB:5uakA	0.673	0.801	7.492E-62	1139	0.240	0.291	5uakA.pdb.gz	Molecular Structure of the Human CFTR Ion Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	650	1215	0.288	0.328	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	655	1408	0.307	0.301	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IC81	672	1518	0.312	0.284	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
4	A0A0S0WIA2	621	1492	0.306	0.284	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
5	A0A1U8QTJ9	638	1396	0.300	0.297	CICA_EMENI ABC-type transporter cicA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicA PE=1 SV=1
6	A7KVC2	626	1510	0.308	0.281	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
7	B2RX12	672	1523	0.319	0.290	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
8	E1B2R7	1013	1426	0.397	0.384	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
9	E7EYG0	1022	1426	0.399	0.386	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
10	E7F118	659	1507	0.315	0.289	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
11	E9Q236	735	1325	0.332	0.346	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
12	F1LR52	707	1288	0.323	0.347	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
13	F1M3J4	721	1325	0.334	0.348	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
14	G5EE72	740	1427	0.317	0.307	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
15	G5EFP3	640	1573	0.318	0.279	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
16	I3L4X2	649	1440	0.288	0.276	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
17	O15438	682	1527	0.337	0.305	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
18	O15439	713	1325	0.331	0.345	MRP4_HUMAN ATP-binding cassette sub-family C member 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3
19	O15440	1033	1437	0.401	0.386	MRP5_HUMAN ATP-binding cassette sub-family C member 5 OS=Homo sapiens OX=9606 GN=ABCC5 PE=1 SV=2
20	O35379	672	1528	0.320	0.289	MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus OX=10090 GN=Abcc1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.8	20.4	AAA ATPase domain
2	PF13304 AAA_21	0.033	25.6	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13401 AAA_22	3.2e+02	13.0	AAA domain
4	PF13476 AAA_23	8.9	18.3	AAA domain
5	PF13555 AAA_29	0.053	24.6	P-loop containing region of AAA domain
6	PF13604 AAA_30	4.9e+02	11.8	AAA domain
7	PF12775 AAA_7	5.4e+02	11.5	P-loop containing dynein motor region
8	PF00664 ABC_membrane	4.3e-45	166.1	ABC transporter transmembrane region
9	PF00005 ABC_tran	1.4e-46	169.8	ABC transporter
10	PF00270 DEAD	4e+02	12.2	DEAD/DEAH box helicase
11	PF01935 DUF87	0.5	22.0	Helicase HerA, central domain
12	PF00350 Dynamin_N	6.7e+02	11.7	Dynamin family
13	PF01580 FtsK_SpoIIIE	2.7e+02	12.3	FtsK/SpoIIIE family
14	PF01926 MMR_HSR1	1.6	20.2	50S ribosome-binding GTPase
15	PF00931 NB-ARC	1.1e+02	13.4	NB-ARC domain
16	PF03193 RsgA_GTPase	9.1	17.6	RsgA GTPase
17	PF02463 SMC_N	1.8e-07	42.4	RecF/RecN/SMC N terminal domain
18	PF00437 T2SSE	31	15.0	Type II/IV secretion system protein
19	PF11712 Vma12	2.8e+02	13.0	Endoplasmic reticulum-based factor for assembly of V-ATPase
20	PF06414 Zeta_toxin	9.7e+02	10.5	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378230

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383900	0.637	Lipase member K
2	9606.ENSP00000287275	0.613	Glycine N-acyltransferase-like protein 2
3	9606.ENSP00000289416	0.610	Acyl-coenzyme A synthetase ACSM3, mitochondrial
4	9606.ENSP00000344403	0.604	Plays a role in spermatogenesis.
5	9606.ENSP00000245539	0.589	Mitochondrial ribosomal protein S7
6	9606.ENSP00000222388	0.570	ATP binding cassette subfamily F member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0140359	0.984	ABC-type transporter activity
GO:0005319	0.981	lipid transporter activity
GO:0005488	0.977	binding
GO:0008028	0.975	monocarboxylic acid transmembrane transporter activity
GO:1901682	0.974	sulfur compound transmembrane transporter activity
GO:0008559	0.974	ABC-type xenobiotic transporter activity
GO:0015125	0.973	bile acid transmembrane transporter activity
GO:0015216	0.970	purine nucleotide transmembrane transporter activity
GO:0005515	0.960	protein binding
GO:0015103	0.952	inorganic anion transmembrane transporter activity
GO:0097159	0.923	organic cyclic compound binding
GO:1901363	0.920	heterocyclic compound binding
GO:0036094	0.724	small molecule binding
GO:0043167	0.704	ion binding
GO:0032559	0.687	adenyl ribonucleotide binding
GO:0043168	0.677	anion binding
GO:0005524	0.658	ATP binding
GO:0015431	0.548	ABC-type glutathione S-conjugate transporter activity
GO:0043225	0.517	ATPase-coupled inorganic anion transmembrane transporter activity
GO:0003824	0.412	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0006810	0.947	transport
GO:0071702	0.901	organic substance transport
GO:0015850	0.841	organic hydroxy compound transport
GO:0015711	0.799	organic anion transport
GO:0015748	0.790	organophosphate ester transport
GO:0055085	0.789	transmembrane transport
GO:0006869	0.770	lipid transport
GO:0006862	0.708	nucleotide transport
GO:0042908	0.692	xenobiotic transport
GO:0015865	0.689	purine nucleotide transport
GO:0015721	0.680	bile acid and bile salt transport
GO:0008152	0.499	metabolic process
GO:0071704	0.411	organic substance metabolic process
GO:0065007	0.335	biological regulation
GO:0050789	0.322	regulation of biological process
GO:0050896	0.308	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043227	0.997	membrane-bounded organelle
GO:0005886	0.993	plasma membrane
GO:0005622	0.936	intracellular anatomical structure
GO:0043231	0.895	intracellular membrane-bounded organelle
GO:0005737	0.804	cytoplasm
GO:0045177	0.797	apical part of cell
GO:0098590	0.725	plasma membrane region
GO:0016324	0.690	apical plasma membrane
GO:0012505	0.585	endomembrane system
GO:0005739	0.546	mitochondrion
GO:0005576	0.449	extracellular region
GO:0005615	0.332	extracellular space
GO:0005654	0.330	nucleoplasm
GO:0065010	0.316	extracellular membrane-bounded organelle
GO:1903561	0.305	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.984	Translocases.
EC:7.6.2.2	0.974	ABC-type xenobiotic transporter.
RHEA:19121	0.548	an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate
EC:7.6.2.3	0.548	ABC-type glutathione-S-conjugate transporter.

[back to server]