StarFunc result for job id Q96J92

User Input

>input (1243 residues)
MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLS
RRSSVDLGLLSSWSLPASPAPDPPDPPDSAGPGPARSPPPSSKEPPEGTWTEGAPVKAAE
DSARPELPDSAVGPGSREPLRVPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDIEI
GRGSFKTVYRGLDTDTTVEVAWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSW
KSVLRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILH
RDLKCDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYA
FGMCMLEMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKVKIPEVKEIIEGCIRTDKNER
FTIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQL
GRDAAEEVAQEMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPP
PATVPMAPGPPSVFPPEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDP
ALQPPGGVPSSLAESHLCLPSAFALSIPRSGPGSDFSPGDSYASDAASGLSDVGEGMGQM
RRPPGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAAMV
YNEFILPSERDGFLRRIREIIQRVETLLKRDTGPMEAAEDTLSPQEEPAPLPALPVPLPD
PSNEELQSSTSLEHRSWTAFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSP
SPFSPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVT
LSSPFFPPCPSTSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPL
PSLPLPPPVAPGGQESPSPHTAEVESEASPPPARPLPGEARLAPISEEGKPQLVGRFQVT
SSKEPAEPLPLQPTSPTLSGSPKPSTPQLTSESSDTEDSAGGGPETREALAESDRAAEGL
GAGVEEEGDDGKEPQVGGSPQPLSHPSPVWMNYSYSSLCLSSEESESSGEDEEFWAELQS
LRQKHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRN
SLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TPK6	0.479	0.486	0.000	1222	0.862	0.876	Q7TPK6.pdb.gz	WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus OX=10116 GN=Wnk4 PE=1 SV=3
2	AFDB:Q96J92	0.999	0.999	0.000	1243	1.000	1.000	Q96J92.pdb.gz	WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens OX=9606 GN=WNK4 PE=1 SV=1
3	AFDB:Q80XP9	0.286	0.207	1.659E-68	1757	0.352	0.249	Q80XP9.pdb.gz	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
4	AFDB:P83741	0.285	0.161	2.140E-65	2377	0.405	0.212	P83741.pdb.gz	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
5	AFDB:Q3UH66	0.280	0.173	2.168E-64	2149	0.430	0.248	Q3UH66.pdb.gz	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
6	AFDB:F1Q6T6	0.292	0.163	2.414E-64	2357	0.454	0.239	F1Q6T6.pdb.gz
7	AFDB:Q9H4A3	0.287	0.159	3.335E-64	2382	0.417	0.217	Q9H4A3.pdb.gz	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
8	AFDB:Q9Y3S1	0.271	0.157	5.619E-57	2297	0.432	0.234	Q9Y3S1.pdb.gz	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
9	AFDB:M9PGC5	0.275	0.142	1.142E-47	2462	0.274	0.139	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
10	AFDB:Q8S8Y9	0.215	0.467	4.308E-36	568	0.140	0.306	Q8S8Y9.pdb.gz	WNK2_ARATH Serine/threonine-protein kinase WNK2 OS=Arabidopsis thaliana OX=3702 GN=WNK2 PE=1 SV=1
11	PDB:6s73A	0.189	0.811	1.312E-18	269	0.064	0.294	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
12	PDB:4d28C	0.187	0.767	3.319E-17	279	0.057	0.254	4d28C.pdb.gz
13	PDB:5ufuA	0.188	0.595	4.117E-17	369	0.060	0.201	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
14	PDB:4krcA	0.181	0.697	6.002E-17	297	0.063	0.263	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
15	PDB:4rerA	0.190	0.487	6.002E-17	459	0.068	0.183	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:5u6yA	0.187	0.489	1.670E-16	459	0.063	0.170	5u6yA.pdb.gz
17	PDB:3eqdA	0.193	0.705	1.860E-16	315	0.054	0.213	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
18	PDB:4c0tA	0.189	0.744	2.434E-16	291	0.051	0.216	4c0tA.pdb.gz
19	PDB:6byrA	0.186	0.544	3.362E-16	405	0.061	0.188	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
20	PDB:3c4wB	0.181	0.415	4.401E-16	519	0.061	0.146	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F2F9	0.0	631	1634	0.236	0.179	E7F2F9_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=2
2	F5GWT4	0.0	641	2134	0.229	0.134	F5GWT4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=1
3	P83741	0.0	639	2377	0.239	0.125	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
4	Q7TPK6	0.0	1827	1222	0.862	0.877	WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus OX=10116 GN=Wnk4 PE=1 SV=3
5	Q80UE6	0.0	1815	1222	0.862	0.876	WNK4_MOUSE Serine/threonine-protein kinase WNK4 OS=Mus musculus OX=10090 GN=Wnk4 PE=1 SV=1
6	Q80XP9	0.0	586	1757	0.228	0.161	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
7	Q96J92	0.0	2472	1243	1.000	1.000	WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens OX=9606 GN=WNK4 PE=1 SV=1
8	Q9BYP7	0.0	589	1800	0.241	0.167	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
9	Q9H4A3	0.0	642	2382	0.229	0.120	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
10	Q9JIH7	0.0	644	2126	0.241	0.141	WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2
11	X1WG08	0.0	633	1606	0.236	0.182	X1WG08_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=1
12	Q3UH66	4.72e-175	571	2149	0.212	0.122	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
13	H0Y7T5	8.69e-174	568	2220	0.212	0.118	H0Y7T5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=1
14	E9PCD1	1.05e-173	568	2217	0.212	0.119	E9PCD1_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
15	Q9Y3S1	3.57e-173	568	2297	0.212	0.114	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
16	X5M5N0	2.18e-134	454	1850	0.171	0.115	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
17	M9PGC5	9.38e-131	446	2462	0.171	0.086	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
18	Q8S8Y9	9.99e-91	306	568	0.137	0.299	WNK2_ARATH Serine/threonine-protein kinase WNK2 OS=Arabidopsis thaliana OX=3702 GN=WNK2 PE=1 SV=1
19	Q9STK6	2.86e-86	292	516	0.131	0.316	WNK3_ARATH Probable serine/threonine-protein kinase WNK3 OS=Arabidopsis thaliana OX=3702 GN=WNK3 PE=2 SV=1
20	Q8S8Y8	6.46e-86	293	567	0.109	0.238	WNK6_ARATH Probable serine/threonine-protein kinase WNK6 OS=Arabidopsis thaliana OX=3702 GN=WNK6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12202 OSR1_C	6.3e-27	104.8	Oxidative-stress-responsive kinase 1 C-terminal domain
2	PF00069 Pkinase	1.1e-49	180.7	Protein kinase domain
3	PF17667 Pkinase_fungal	1.3e+02	12.8	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	1.8e-37	140.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246914

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312397	0.997	Kelch-like protein 3
2	9606.ENSP00000300061	0.970	Amiloride-sensitive sodium channel subunit gamma
3	9606.ENSP00000353292	0.970	Amiloride-sensitive sodium channel subunit alpha
4	9606.ENSP00000345751	0.951	Amiloride-sensitive sodium channel subunit beta
5	9606.ENSP00000368411	0.929	Amiloride-sensitive sodium channel subunit delta
6	9606.ENSP00000376432	0.920	ATP-sensitive inward rectifier potassium channel 1
7	9606.ENSP00000402152	0.916	Solute carrier family 12 member 3
8	9606.ENSP00000262461	0.906	Solute carrier family 12 member 2
9	9606.ENSP00000379822	0.902	Solute carrier family 12 member 1
10	9606.ENSP00000388107	0.901	Ubiquitin-60S ribosomal protein L40
11	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
12	9606.ENSP00000304697	0.900	Polyubiquitin-B
13	9606.ENSP00000424198	0.900	Kelch-like protein 2
14	9606.ENSP00000441543	0.900	Polyubiquitin-C
15	9606.ENSP00000311713	0.886	Serine/threonine-protein kinase OSR1
16	9606.ENSP00000265310	0.861	Transient receptor potential cation channel subfamily V member 5
17	9606.ENSP00000264414	0.853	Cullin-3
18	9606.ENSP00000348278	0.850	STE20/SPS1-related proline-alanine-rich protein kinase
19	9606.ENSP00000258418	0.844	Calcium-binding protein 39
20	9606.ENSP00000370719	0.800	Intersectin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016247	0.999	channel regulator activity
GO:0005515	0.999	protein binding
GO:0004672	0.999	protein kinase activity
GO:0099106	0.992	ion channel regulator activity
GO:0004674	0.979	protein serine/threonine kinase activity
GO:0016248	0.976	channel inhibitor activity
GO:0008200	0.973	ion channel inhibitor activity
GO:0043168	0.780	anion binding
GO:0031404	0.732	chloride ion binding
GO:0019899	0.378	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.975	biological regulation
GO:0051234	0.970	establishment of localization
GO:0050789	0.961	regulation of biological process
GO:0044237	0.956	cellular metabolic process
GO:0006810	0.941	transport
GO:0032501	0.939	multicellular organismal process
GO:0071704	0.888	organic substance metabolic process
GO:0006807	0.865	nitrogen compound metabolic process
GO:1901564	0.855	organonitrogen compound metabolic process
GO:0043170	0.841	macromolecule metabolic process
GO:0044238	0.759	primary metabolic process
GO:0006811	0.662	monoatomic ion transport
GO:0006796	0.660	phosphate-containing compound metabolic process
GO:0019538	0.648	protein metabolic process
GO:0043412	0.630	macromolecule modification
GO:0048519	0.618	negative regulation of biological process
GO:0042592	0.602	homeostatic process
GO:0050794	0.546	regulation of cellular process
GO:0016310	0.517	phosphorylation
GO:0050896	0.514	response to stimulus
GO:0036211	0.500	protein modification process
GO:0032502	0.463	developmental process
GO:0030001	0.454	metal ion transport
GO:0048878	0.444	chemical homeostasis
GO:0006468	0.401	protein phosphorylation
GO:0065008	0.361	regulation of biological quality
GO:0048518	0.323	positive regulation of biological process
GO:0098660	0.311	inorganic ion transmembrane transport
GO:0051049	0.309	regulation of transport
GO:0034220	0.305	monoatomic ion transmembrane transport
GO:0048856	0.300	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.995	membrane
GO:0005829	0.992	cytosol
GO:0071944	0.866	cell periphery
GO:0005886	0.855	plasma membrane
GO:0043226	0.712	organelle
GO:0043227	0.676	membrane-bounded organelle
GO:0043229	0.647	intracellular organelle
GO:0032991	0.312	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]