StarFunc result for job id Q96J94

User Input

>input (861 residues)
MTGRARARARGRARGQETAQLVGSTASQQPGYIQPRPQPPPAEGELFGRGRQRGTAGGTA
KSQGLQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
LTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTE
VFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPID
IPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS
KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQP
VLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQRE
VGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSK
ETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEA
YLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAI
ATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFS
RCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQF
LDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIV
SQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAF
LVGQSIHREPNLSLSNRLYYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VKG8	0.886	0.895	0.000	852	0.489	0.494	A0A140VKG8.pdb.gz	A0A140VKG8_HUMAN Piwi-like 4 (Drosophila), isoform CRA_a OS=Homo sapiens OX=9606 GN=PIWIL4 PE=2 SV=1
2	AFDB:A2CEI6	0.863	0.712	0.000	1046	0.404	0.333	A2CEI6.pdb.gz	PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio OX=7955 GN=piwil2 PE=1 SV=2
3	AFDB:Q4G033	0.867	0.880	0.000	848	0.494	0.501	Q4G033.pdb.gz	PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus OX=10116 GN=Piwil4 PE=2 SV=2
4	AFDB:Q7Z3Z3	0.858	0.839	0.000	882	0.516	0.503	Q7Z3Z3.pdb.gz	PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens OX=9606 GN=PIWIL3 PE=2 SV=2
5	AFDB:Q8UVX0	0.915	0.919	0.000	858	0.648	0.650	Q8UVX0.pdb.gz	PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwil1 PE=1 SV=1
6	AFDB:Q9JMB7	0.904	0.903	0.000	862	0.949	0.948	Q9JMB7.pdb.gz	PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus OX=10090 GN=Piwil1 PE=1 SV=1
7	AFDB:Q8CDG1	0.860	0.764	7.037E-104	971	0.397	0.352	Q8CDG1.pdb.gz	PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus OX=10090 GN=Piwil2 PE=1 SV=2
8	AFDB:Q8TC59	0.857	0.760	6.015E-102	973	0.396	0.350	Q8TC59.pdb.gz	PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens OX=9606 GN=PIWIL2 PE=1 SV=1
9	AFDB:A8KBF3	0.858	0.779	6.703E-102	949	0.397	0.360	A8KBF3.pdb.gz	PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis OX=8364 GN=piwil2 PE=1 SV=1
10	AFDB:Q7PLK0	0.852	0.846	1.813E-98	867	0.373	0.370	Q7PLK0.pdb.gz	AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster OX=7227 GN=AGO3 PE=1 SV=3
11	PDB:5guhA	0.802	0.904	2.412E-88	759	0.348	0.395	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
12	PDB:6kr6A	0.701	0.833	4.180E-79	713	0.314	0.379	6kr6A.pdb.gz	Crystal structure of Drosophila Piwi.
13	PDB:4krfA	0.699	0.733	2.044E-60	817	0.209	0.220	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
14	PDB:4w5tA	0.711	0.754	1.782E-59	807	0.216	0.230	4w5tA.pdb.gz	Gene regulation. Structural basis for microRNA targeting.
15	PDB:6oonA	0.691	0.752	1.033E-57	785	0.210	0.231	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
16	PDB:5vm9C	0.708	0.770	3.384E-55	785	0.215	0.236	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
17	PDB:5weaA	0.677	0.756	9.464E-55	764	0.209	0.236	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
18	PDB:7swfA	0.635	0.696	2.416E-49	778	0.196	0.217	7swfA.pdb.gz	The molecular mechanism of microRNA duplex selectivity of Arabidopsis ARGONAUTE10.
19	PDB:7kpvD	0.452	0.446	5.824E-16	876	0.098	0.096	7kpvD.pdb.gz
20	PDB:8dgaA	0.096	0.063	5.272E-7	1629	0.064	0.034	8dgaA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VKG8	0.0	858	852	0.491	0.496	A0A140VKG8_HUMAN Piwi-like 4 (Drosophila), isoform CRA_a OS=Homo sapiens OX=9606 GN=PIWIL4 PE=2 SV=1
2	A2CEI6	0.0	721	1046	0.384	0.316	PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio OX=7955 GN=piwil2 PE=1 SV=2
3	A8D8P8	0.0	587	899	0.351	0.336	SIWI_BOMMO Piwi-like protein Siwi OS=Bombyx mori OX=7091 GN=Siwi PE=1 SV=1
4	A8KBF3	0.0	698	949	0.387	0.351	PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis OX=8364 GN=piwil2 PE=1 SV=1
5	A9ZSZ2	0.0	652	926	0.404	0.376	AGO3_BOMMO Piwi-like protein Ago3 OS=Bombyx mori OX=7091 GN=AGO3 PE=1 SV=2
6	O76922	0.0	580	866	0.352	0.350	AUB_DROME Protein aubergine OS=Drosophila melanogaster OX=7227 GN=aub PE=1 SV=1
7	Q4G033	0.0	878	848	0.494	0.501	PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus OX=10116 GN=Piwil4 PE=2 SV=2
8	Q7PLK0	0.0	635	867	0.365	0.362	AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster OX=7227 GN=AGO3 PE=1 SV=3
9	Q7Z3Z3	0.0	855	882	0.503	0.491	PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens OX=9606 GN=PIWIL3 PE=2 SV=2
10	Q7Z3Z4	0.0	858	852	0.491	0.496	PIWL4_HUMAN Piwi-like protein 4 OS=Homo sapiens OX=9606 GN=PIWIL4 PE=1 SV=2
11	Q8CDG1	0.0	691	971	0.380	0.337	PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus OX=10090 GN=Piwil2 PE=1 SV=2
12	Q8CGT6	0.0	863	848	0.492	0.500	PIWL4_MOUSE Piwi-like protein 4 OS=Mus musculus OX=10090 GN=Piwil4 PE=1 SV=3
13	Q8TC59	0.0	690	973	0.377	0.334	PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens OX=9606 GN=PIWIL2 PE=1 SV=1
14	Q8UVX0	0.0	1174	858	0.632	0.634	PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwil1 PE=1 SV=1
15	Q96J94	0.0	1796	861	1.000	1.000	PIWL1_HUMAN Piwi-like protein 1 OS=Homo sapiens OX=9606 GN=PIWIL1 PE=1 SV=1
16	Q9JMB7	0.0	1688	862	0.933	0.932	PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus OX=10090 GN=Piwil1 PE=1 SV=1
17	Q9VKM1	0.0	554	843	0.340	0.348	PIWI_DROME Protein piwi OS=Drosophila melanogaster OX=7227 GN=piwi PE=1 SV=1
18	P90786	1.67e-163	498	824	0.323	0.337	P90786_CAEEL Piwi-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=prg-1 PE=1 SV=1
19	Q7KWS3	1.06e-121	393	979	0.287	0.252	Q7KWS3_DICDI Argonaut-like protein OS=Dictyostelium discoideum OX=44689 GN=agnA PE=3 SV=1
20	Q54G64	4.70e-121	390	900	0.301	0.288	Q54G64_DICDI Argonaut-like protein OS=Dictyostelium discoideum OX=44689 GN=agnB PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08699 ArgoL1	0.081	23.9	Argonaute linker 1 domain
2	PF16486 ArgoN	0.04	25.8	N-terminal domain of argonaute
3	PF05831 GAGE	8.7e-24	95.5	GAGE protein
4	PF02170 PAZ	2.7e-32	123.1	PAZ domain
5	PF02171 Piwi	2.9e-103	356.9	Piwi domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357812	0.998	Tudor and KH domain-containing protein
2	9606.ENSP00000346065	0.996	Tudor domain-containing protein 6
3	9606.ENSP00000251864	0.986	Tudor domain-containing protein 1
4	9606.ENSP00000437256	0.978	Endoribonuclease Dicer
5	9606.ENSP00000359049	0.975	Small RNA 2'-O-methyltransferase
6	9606.ENSP00000348132	0.947	Serine/threonine kinase 31
7	9606.ENSP00000262794	0.944	RNA helicase Mov10l1
8	9606.ENSP00000346762	0.944	Staphylococcal nuclease domain-containing protein 1
9	9606.ENSP00000335153	0.931	Heat shock protein HSP 90-alpha
10	9606.ENSP00000356846	0.930	Protein maelstrom homolog
11	9606.ENSP00000369786	0.914	Pirin
12	9606.ENSP00000379144	0.903	Trinucleotide repeat-containing gene 6A protein
13	9606.ENSP00000255324	0.887	RING finger protein 17
14	9606.ENSP00000425561	0.860	Eukaryotic translation initiation factor 4E
15	9606.ENSP00000387303	0.824	ATP-dependent RNA helicase TDRD9
16	9606.ENSP00000425979	0.823	Ribonuclease 3
17	9606.ENSP00000317177	0.821	Mitochondrial cardiolipin hydrolase
18	9606.ENSP00000347444	0.816	Tudor domain-containing protein 7
19	9606.ENSP00000406052	0.807	Tudor domain-containing protein 5
20	9606.ENSP00000341992	0.805	Nanos homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0061980	0.999	regulatory RNA binding
GO:0034584	0.983	piRNA binding
GO:0003824	0.921	catalytic activity
GO:0140640	0.848	catalytic activity, acting on a nucleic acid
GO:0140098	0.843	catalytic activity, acting on RNA
GO:0016787	0.786	hydrolase activity
GO:0004521	0.778	RNA endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0000003	0.995	reproduction
GO:0022412	0.992	cellular process involved in reproduction in multicellular organism
GO:0003006	0.991	developmental process involved in reproduction
GO:0007276	0.983	gamete generation
GO:0050789	0.982	regulation of biological process
GO:0048869	0.979	cellular developmental process
GO:0007283	0.974	spermatogenesis
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0010468	0.945	regulation of gene expression
GO:0048519	0.939	negative regulation of biological process
GO:0044238	0.922	primary metabolic process
GO:0071704	0.920	organic substance metabolic process
GO:0006807	0.910	nitrogen compound metabolic process
GO:0048856	0.908	anatomical structure development
GO:0043170	0.904	macromolecule metabolic process
GO:0048515	0.892	spermatid differentiation
GO:0050794	0.889	regulation of cellular process
GO:0007281	0.882	germ cell development
GO:0007286	0.863	spermatid development
GO:0044237	0.851	cellular metabolic process
GO:0010605	0.812	negative regulation of macromolecule metabolic process
GO:0034641	0.740	cellular nitrogen compound metabolic process
GO:0006725	0.735	cellular aromatic compound metabolic process
GO:0090304	0.732	nucleic acid metabolic process
GO:0010629	0.691	negative regulation of gene expression
GO:0016070	0.647	RNA metabolic process
GO:0010467	0.612	gene expression
GO:0071840	0.490	cellular component organization or biogenesis
GO:0048523	0.456	negative regulation of cellular process
GO:0006396	0.432	RNA processing
GO:0016043	0.399	cellular component organization
GO:0031323	0.362	regulation of cellular metabolic process
GO:0070918	0.352	regulatory ncRNA processing
GO:0051171	0.339	regulation of nitrogen compound metabolic process
GO:0080090	0.320	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0099080	0.995	supramolecular complex
GO:0036464	0.990	cytoplasmic ribonucleoprotein granule
GO:0005829	0.980	cytosol
GO:0005654	0.950	nucleoplasm
GO:0032991	0.404	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.786	Hydrolases.
EC:3.1.-.-	0.778	Acting on ester bonds.

[back to server]