StarFunc result for job id Q96JA1

User Input

>input (1093 residues)
MARPVRGGLGAPRRSPCLLLLWLLLLRLEPVTAAAGPRAPCAAACTCAGDSLDCGGRGLA
ALPGDLPSWTRSLNLSYNKLSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSL
FLQHNKIRSVEGSQLKAYLSLEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLEL
GAFDGLSRSLLTLRLSKNRITQLPVRAFKLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVL
KLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSIARIHR
KGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGAFKGLRSLRVL
DLDHNEISGTIEDTSGAFSGLDSLSKLTLFGNKIKSVAKRAFSGLEGLEHLNLGGNAIRS
VQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLIGRMLQAFVTATCAHPESLKGQSIF
SVPPESFVCDDFLKPQIITQPETTMAMVGKDIRFTCSAASSSSSPMTFAWKKDNEVLTNA
DMENFVHVHAQDGEVMEYTTILHLRQVTFGHEGRYQCVITNHFGSTYSHKARLTVNVLPS
FTKTPHDITIRTTTMARLECAATGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFIT
DVKIDDAGVYSCTAQNSAGSISANATLTVLETPSLVVPLEDRVVSVGETVALQCKATGNP
PPRITWFKGDRPLSLTERHHLTPDNQLLVVQNVVAEDAGRYTCEMSNTLGTERAHSQLSV
LPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETVVPPDVP
SYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAG
SAYHKEPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYSRGQAFHPQPVSRDSAQPS
APNGPEPGGSDQEHSPHHQCSRTAAGSCPECQGSLYPSNHDRMLTAVKKKPMASLDGKGD
SSWTLARLYHPDSTELQPASSLTSGSPERAEAQYLLVSNGHLPKACDASPESTPLTGQLP
GKQRVPLLLAPKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70193	0.519	0.520	0.000	1091	0.832	0.833	P70193.pdb.gz	LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus OX=10090 GN=Lrig1 PE=1 SV=2
2	AFDB:Q96JA1	1.000	1.000	0.000	1093	1.000	1.000	Q96JA1.pdb.gz	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2
3	AFDB:D3ZB51	0.122	0.105	6.692E-18	1328	0.129	0.106	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
4	PDB:7wv3A	0.175	0.234	1.250E-15	668	0.109	0.178	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
5	PDB:6dldD	0.186	0.628	1.639E-15	269	0.059	0.242	6dldD.pdb.gz
6	PDB:7tvfD	0.297	0.567	1.428E-14	515	0.101	0.214	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
7	AFDB:Q96RT1	0.276	0.219	1.564E-14	1412	0.147	0.114	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
8	AFDB:Q80TH2	0.281	0.225	2.688E-14	1402	0.150	0.117	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
9	AFDB:P70587	0.303	0.227	4.033E-14	1490	0.159	0.117	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
10	AFDB:Q0KIB0	0.146	0.103	5.286E-14	1689	0.085	0.055	Q0KIB0.pdb.gz	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1
11	AFDB:A0A0B4K6Z6	0.150	0.091	1.088E-13	2037	0.065	0.035	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
12	PDB:6gffI	0.277	0.494	3.509E-13	551	0.122	0.241	6gffI.pdb.gz
13	PDB:6dlfA	0.160	0.601	4.203E-13	236	0.051	0.237	6dlfA.pdb.gz
14	PDB:7wrqA	0.274	0.470	1.358E-12	566	0.126	0.244	7wrqA.pdb.gz
15	AFDB:A0A2R8QME5	0.167	0.167	3.202E-12	1094	0.081	0.081	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
16	AFDB:F1QRP2	0.150	0.146	6.893E-12	1135	0.090	0.086	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
17	PDB:3t6qA	0.229	0.379	7.202E-12	601	0.100	0.181	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:5oj2B	0.150	0.224	1.942E-11	692	0.061	0.097	5oj2B.pdb.gz
19	PDB:5y31B	0.135	0.270	3.652E-11	511	0.079	0.168	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
20	PDB:2ft3F	0.184	0.499	1.852E-10	305	0.081	0.289	2ft3F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94898	0.0	910	1065	0.453	0.465	LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=1 SV=3
2	P70193	0.0	1740	1091	0.833	0.834	LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus OX=10090 GN=Lrig1 PE=1 SV=2
3	Q52KR2	0.0	905	1054	0.453	0.470	LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1
4	Q6P1C6	0.0	1011	1117	0.457	0.448	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
5	Q6UXM1	0.0	1002	1119	0.454	0.443	LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=1 SV=1
6	Q96JA1	0.0	2259	1093	1.000	1.000	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2
7	Q965M2	1.17e-99	337	881	0.213	0.264	SMA10_CAEEL Leucine-rich repeats and immunoglobulin-like domains protein sma-10 OS=Caenorhabditis elegans OX=6239 GN=sma-10 PE=1 SV=1
8	Q3UQ28	1.02e-56	217	1475	0.138	0.102	PXDN_MOUSE Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2
9	Q92626	1.10e-56	217	1479	0.135	0.100	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2
10	P70389	2.91e-42	166	603	0.131	0.237	ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus OX=10090 GN=Igfals PE=1 SV=1
11	Q8R5M3	1.91e-41	163	578	0.121	0.228	LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus OX=10116 GN=Lrrc15 PE=2 SV=1
12	Q3UVD5	2.01e-41	167	967	0.144	0.162	LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus OX=10090 GN=Lgr6 PE=2 SV=1
13	P35859	9.50e-41	162	603	0.124	0.224	ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus OX=10116 GN=Igfals PE=1 SV=1
14	P35858	1.73e-40	161	605	0.123	0.221	ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens OX=9606 GN=IGFALS PE=1 SV=1
15	F1RCV3	1.22e-39	162	1516	0.127	0.092	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
16	O75093	2.91e-39	161	1534	0.127	0.091	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
17	O88279	3.31e-39	161	1531	0.126	0.090	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
18	Q9VZZ4	3.47e-39	161	1527	0.126	0.090	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
19	Q9HBX8	3.59e-39	160	967	0.135	0.153	LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens OX=9606 GN=LGR6 PE=1 SV=3
20	Q80TR4	6.39e-39	160	1531	0.130	0.093	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	6.2	18.6	Immunoglobulin C1-set domain
2	PF05790 C2-set	1.5e+02	14.0	Immunoglobulin C2-set domain
3	PF08205 C2-set_2	2.2e-07	42.1	CD80-like C2-set immunoglobulin domain
4	PF09967 DUF2201	3.7e+02	12.7	VWA-like domain (DUF2201)
5	PF07679 I-set	5.5e-52	185.1	Immunoglobulin I-set domain
6	PF00047 ig	2.8e-25	99.6	Immunoglobulin domain
7	PF13895 Ig_2	3.4e-34	128.3	Immunoglobulin domain
8	PF13927 Ig_3	1.5e-44	161.8	Immunoglobulin domain
9	PF16680 Ig_4	3.6	19.6	T-cell surface glycoprotein CD3 delta chain
10	PF16681 Ig_5	0.0014	30.3	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
11	PF18452 Ig_6	1.9	19.7	Immunoglobulin domain
12	PF17736 Ig_C17orf99	2.1	19.8	C17orf99 Ig domain
13	PF16706 Izumo-Ig	4.7	18.5	Izumo-like Immunoglobulin domain
14	PF01463 LRRCT	0.0043	28.5	Leucine rich repeat C-terminal domain
15	PF01462 LRRNT	17	16.5	Leucine rich repeat N-terminal domain
16	PF00560 LRR_1	1.4e-05	35.8	Leucine Rich Repeat
17	PF12799 LRR_4	1.3e-37	138.2	Leucine Rich repeats (2 copies)
18	PF13306 LRR_5	3.3e-18	77.3	BspA type Leucine rich repeat region (6 copies)
19	PF13516 LRR_6	0.043	24.9	Leucine Rich repeat
20	PF13855 LRR_8	1.3e-68	238.0	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.996	Epidermal growth factor receptor
2	9606.ENSP00000342235	0.980	Receptor tyrosine-protein kinase erbB-4
3	9606.ENSP00000379721	0.958	Ubiquitin carboxyl-terminal hydrolase 8
4	9606.ENSP00000264033	0.956	E3 ubiquitin-protein ligase CBL
5	9606.ENSP00000265171	0.954	Pro-epidermal growth factor
6	9606.ENSP00000317272	0.922	Hepatocyte growth factor receptor
7	9606.ENSP00000230990	0.921	Proheparin-binding EGF-like growth factor
8	9606.ENSP00000269571	0.920	Receptor tyrosine-protein kinase erbB-2
9	9606.ENSP00000244869	0.918	Proepiregulin
10	9606.ENSP00000379097	0.917	Amphiregulin
11	9606.ENSP00000411898	0.916	Epigen
12	9606.ENSP00000295400	0.911	Protransforming growth factor alpha
13	9606.ENSP00000384620	0.909	Pro-neuregulin-1, membrane-bound isoform
14	9606.ENSP00000272317	0.906	Ubiquitin-40S ribosomal protein S27a
15	9606.ENSP00000304697	0.906	Polyubiquitin-B
16	9606.ENSP00000441543	0.906	Polyubiquitin-C
17	9606.ENSP00000379092	0.905	Probetacellulin
18	9606.ENSP00000261769	0.900	Cadherin-1
19	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
20	9606.ENSP00000385735	0.820	Galactosylceramide sulfotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.422	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.949	anatomical structure development
GO:0032501	0.936	multicellular organismal process
GO:0007275	0.918	multicellular organism development
GO:0009987	0.897	cellular process
GO:0065007	0.859	biological regulation
GO:0009653	0.859	anatomical structure morphogenesis
GO:0050789	0.839	regulation of biological process
GO:0050794	0.822	regulation of cellular process
GO:0048513	0.821	animal organ development
GO:0048731	0.796	system development
GO:0007423	0.622	sensory organ development
GO:0009887	0.574	animal organ morphogenesis
GO:0048518	0.551	positive regulation of biological process
GO:0050896	0.531	response to stimulus
GO:0048522	0.496	positive regulation of cellular process
GO:0048519	0.469	negative regulation of biological process
GO:0043583	0.413	ear development
GO:0048840	0.396	otolith development
GO:0051716	0.376	cellular response to stimulus
GO:0007399	0.368	nervous system development
GO:0042472	0.362	inner ear morphogenesis
GO:0048583	0.325	regulation of response to stimulus
GO:0048523	0.317	negative regulation of cellular process
GO:0007165	0.312	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.915	membrane-bounded organelle
GO:0043231	0.794	intracellular membrane-bounded organelle
GO:0005737	0.791	cytoplasm
GO:0031982	0.583	vesicle
GO:0012505	0.500	endomembrane system
GO:0005576	0.368	extracellular region
GO:0005615	0.330	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]