StarFunc result for job id Q96JB1

User Input

>input (1400 residues)
MMKLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLAN
IFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNF
SKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWK
RMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTL
EKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAY
ITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFG
KFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRT
EFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTI
ERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNSD
ILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVN
FDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSV
FVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHID
TVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIFEQ
IYEVKYTGKVGKQSEQRKHVVFGSETGEGENNDYEANIVNEFDTHDKEDEFKKECKEVFA
FFSHQLLDSLQKATRLSLDTMKRRIFVASLYGRKQSEDIISFIKSEVHLAIPNVVMIPSL
DDIQQAINRMIQLTLEVSRGVAHWGQQQIRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF
EEAIPARKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDV
KVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWK
MLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTL
GPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLES
VEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGL
PVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCR
KLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSF
CLRNIMEAPLLKHKDDIEDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.247	0.088	3.693E-30	4579	0.136	0.042	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:7kzmC	0.355	0.144	1.986E-25	3890	0.230	0.083	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
3	AFDB:A0A0R4IUQ6	0.246	0.513	3.620E-16	614	0.073	0.166	A0A0R4IUQ6.pdb.gz
4	AFDB:Q9VN30	0.218	0.269	3.130E-14	1079	0.076	0.099	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
5	AFDB:Q5SX07	0.245	0.652	3.088E-13	457	0.067	0.206	Q5SX07.pdb.gz	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
6	PDB:7z8jf	0.204	0.375	2.967E-11	674	0.077	0.160	7z8jf.pdb.gz
7	AFDB:Q9P7V5	0.064	0.054	2.213E-3	1822	0.141	0.109	Q9P7V5.pdb.gz	SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec72 PE=1 SV=1
8	AFDB:Q5AL52	0.062	0.053	2.394E-3	1732	0.148	0.120	Q5AL52.pdb.gz	BNI1_CANAL Formin BNI1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNI1 PE=1 SV=1
9	PDB:7n6g1N	0.077	0.061	2.880E-3	2179	0.111	0.072	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
10	AFDB:Q9VAJ1	0.062	0.061	3.034E-3	1380	0.107	0.109	Q9VAJ1.pdb.gz	Q9VAJ1_DROME Condensin complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cap-D2 PE=1 SV=1
11	PDB:7owgB	0.079	0.058	3.650E-3	2152	0.113	0.073	7owgB.pdb.gz
12	PDB:7usdA	0.053	0.059	4.109E-3	1185	0.115	0.136	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
13	PDB:7mq8LM	0.073	0.061	5.634E-3	2005	0.133	0.093	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7r5jB0	0.054	0.047	6.097E-3	1748	0.095	0.076	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	AFDB:Q9FFF3	0.078	0.095	7.823E-3	1068	0.077	0.101	Q9FFF3.pdb.gz	COG1_ARATH Conserved oligomeric Golgi complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=COG1 PE=1 SV=1
16	AFDB:Q63128	0.086	0.120	1.208E-2	941	0.100	0.149	Q63128.pdb.gz	Q63128_RAT CPG2 protein OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
17	AFDB:D4A678	0.082	0.058	1.414E-2	2416	0.142	0.082	D4A678.pdb.gz	D4A678_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=4
18	AFDB:E7F4L4	0.055	0.062	1.471E-2	1173	0.106	0.127	E7F4L4.pdb.gz	E7F4L4_DANRE WASH complex subunit 4 OS=Danio rerio OX=7955 GN=si:dkey-23p11.2 PE=1 SV=1
19	PDB:7nfeA	0.080	0.045	1.511E-2	3585	0.134	0.052	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
20	PDB:6lqsRP	0.064	0.050	1.701E-2	2180	0.125	0.080	6lqsRP.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LH20	0.0	748	4724	0.338	0.100	A0A0B4LH20_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Dhc1 PE=3 SV=1
2	A8Y5B7	0.0	676	4593	0.296	0.090	A8Y5B7_DROME Male fertility factor kl3 OS=Drosophila melanogaster OX=7227 GN=kl-3 PE=1 SV=3
3	Q39575	0.0	746	4485	0.324	0.101	DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA2 PE=1 SV=1
4	Q57WX6	0.0	646	4639	0.312	0.094	Q57WX6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.490 PE=4 SV=1
5	Q8TE73	0.0	1182	4624	0.437	0.132	DYH5_HUMAN Dynein axonemal heavy chain 5 OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3
6	Q8VHE6	0.0	1154	4621	0.430	0.130	DYH5_MOUSE Dynein axonemal heavy chain 5 OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2
7	Q96JB1	0.0	2883	4490	1.000	0.312	DYH8_HUMAN Dynein axonemal heavy chain 8 OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2
8	Q9SMH3	1.25e-95	344	4625	0.226	0.069	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
9	E7FGT8	1.21e-93	338	4626	0.221	0.067	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
10	D3YYQ8	3.55e-84	308	4591	0.217	0.066	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
11	Q9GPN7	1.92e-83	306	4350	0.144	0.046	Q9GPN7_DROME Gamma dynein OS=Drosophila melanogaster OX=7227 GN=kl-3 PE=2 SV=2
12	F7ABZ6	8.73e-77	285	4534	0.215	0.066	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
13	B1AR51	2.33e-60	232	4484	0.204	0.064	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
14	Q9MBF8	7.76e-42	171	4513	0.122	0.038	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
15	E9Q7N9	1.44e-39	164	4488	0.113	0.035	E9Q7N9_MOUSE Dynein, axonemal, heavy chain 11 OS=Mus musculus OX=10090 GN=Dnah11 PE=1 SV=2
16	Q580B5	1.45e-39	164	4448	0.117	0.037	Q580B5_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.710 PE=4 SV=1
17	Q9QZH1	3.90e-39	162	4488	0.112	0.035	Q9QZH1_MOUSE Left-right dynein OS=Mus musculus OX=10090 GN=Dnah11 PE=2 SV=1
18	F1SC07	8.56e-37	155	4518	0.115	0.036	DYH11_PIG Dynein axonemal heavy chain 11 OS=Sus scrofa OX=9823 GN=DNAH11 PE=1 SV=4
19	Q9NYC9	8.50e-36	152	4486	0.105	0.033	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
20	Q9UFH2	5.04e-35	149	4462	0.104	0.032	DYH17_HUMAN Dynein axonemal heavy chain 17 OS=Homo sapiens OX=9606 GN=DNAH17 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08385 DHC_N1	9.4e-164	557.8	Dynein heavy chain, N-terminal region 1
2	PF08393 DHC_N2	1.6e-25	101.6	Dynein heavy chain, N-terminal region 2
3	PF07471 Phage_Nu1	2.8e+02	12.7	Phage DNA packaging protein Nu1
4	PF12783 Sec7_N	3.8e+02	12.4	Guanine nucleotide exchange factor in Golgi transport N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333363

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380378	0.939	Platelet-activating factor acetylhydrolase IB subunit alpha
2	9606.ENSP00000354791	0.936	Dynactin subunit 1
3	9606.ENSP00000479322	0.933	CAP-Gly domain-containing linker protein 1
4	9606.ENSP00000408910	0.926	Dynactin subunit 2
5	9606.ENSP00000374490	0.924	Dynein heavy chain 17, axonemal
6	9606.ENSP00000261383	0.918	Dynein heavy chain 3, axonemal
7	9606.ENSP00000374045	0.916	Dynein heavy chain 6, axonemal
8	9606.ENSP00000458355	0.916	Dynein heavy chain 2, axonemal
9	9606.ENSP00000318429	0.914	Coiled-coil domain-containing protein 114
10	9606.ENSP00000400252	0.913	Dynein intermediate chain 2, axonemal
11	9606.ENSP00000401514	0.910	Dynein heavy chain 1, axonemal
12	9606.ENSP00000310829	0.906	Cilia- and flagella-associated protein 70
13	9606.ENSP00000265104	0.902	Dynein heavy chain 5, axonemal
14	9606.ENSP00000259632	0.901	Dynactin subunit 3
15	9606.ENSP00000221114	0.900	Dynactin subunit 6
16	9606.ENSP00000480538	0.879	Dynein intermediate chain 1, axonemal
17	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
18	9606.ENSP00000289228	0.820	Beta-centractin
19	9606.ENSP00000358921	0.820	Alpha-centractin
20	9606.ENSP00000414906	0.807	Dynactin subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003777	1.000	microtubule motor activity
GO:0005515	0.970	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.940	cellular process
GO:0007017	0.903	microtubule-based process
GO:0003341	0.705	cilium movement

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005930	0.999	axoneme
GO:0031514	0.997	motile cilium
GO:0097729	0.994	9+2 motile cilium
GO:0032991	0.617	protein-containing complex
GO:0036126	0.397	sperm flagellum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]