StarFunc result for job id Q96JB5

User Input

>input (506 residues)
MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSG
SYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVR
NVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELL
ALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYE
WRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPES
DSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMEL
EIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHL
FMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTK
ELQKLIEADISKRYSGRPVNLMGTSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96JB5	1.000	1.000	1.331E-66	506	1.000	1.000	Q96JB5.pdb.gz	CK5P3_HUMAN CDK5 regulatory subunit-associated protein 3 OS=Homo sapiens OX=9606 GN=CDK5RAP3 PE=1 SV=2
2	AFDB:Q9JLH7	0.964	0.968	3.006E-58	504	0.872	0.875	Q9JLH7.pdb.gz	CK5P3_RAT CDK5 regulatory subunit-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Cdk5rap3 PE=1 SV=1
3	AFDB:F1Q5I0	0.869	0.867	1.087E-46	507	0.632	0.631	F1Q5I0.pdb.gz
4	AFDB:Q95SK3	0.704	0.700	2.163E-29	509	0.354	0.352	Q95SK3.pdb.gz	CK5P3_DROME CDK5RAP3-like protein OS=Drosophila melanogaster OX=7227 GN=CG30291 PE=2 SV=1
5	AFDB:Q8IM46	0.128	0.083	4.437E-2	964	0.105	0.055	Q8IM46.pdb.gz	YPF02_PLAF7 Uncharacterized protein PF3D7_1404800 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF14_0045 PE=1 SV=2
6	AFDB:Q2W8M7	0.130	0.148	9.362E-2	436	0.101	0.117	Q2W8M7.pdb.gz	MCP10_MAGSA Methyl-accepting chemotaxis protein Amb0994 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=amb0994 PE=1 SV=1
7	AFDB:P42259	0.159	0.153	2.686E-1	534	0.115	0.109	P42259.pdb.gz	HTR2_NATPH Sensory rhodopsin II transducer OS=Natronomonas pharaonis OX=2257 GN=htr2 PE=1 SV=1
8	AFDB:A0A1D8PJD1	0.140	0.065	3.496E-1	1332	0.126	0.048	A0A1D8PJD1.pdb.gz	A0A1D8PJD1_CANAL MRX complex DNA-binding subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD50 PE=4 SV=1
9	AFDB:Q9I3F6	0.135	0.132	3.496E-1	521	0.097	0.094	Q9I3F6.pdb.gz	AER_PSEAE Methyl-accepting chemotaxis protein Aer OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=aer PE=1 SV=1
10	AFDB:F4I2I5	0.123	0.070	5.190E-1	1013	0.123	0.061	F4I2I5.pdb.gz	F4I2I5_ARATH Guanylate-binding family protein OS=Arabidopsis thaliana OX=3702 GN=GBPL1 PE=1 SV=1
11	PDB:7sqcC2	0.107	0.043	9.829E-1	1498	0.138	0.047	7sqcC2.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:6yvuB	0.133	0.062	1.593	1191	0.170	0.072	6yvuB.pdb.gz
13	PDB:7ogtB	0.123	0.095	2.074	708	0.138	0.099	7ogtB.pdb.gz
14	PDB:6yvuA	0.111	0.056	2.699	1127	0.142	0.064	6yvuA.pdb.gz
15	PDB:2jjpA	0.077	0.094	3.361	397	0.024	0.030	2jjpA.pdb.gz	Azole Drugs Trap Cytochrome P450 Eryk in Alternative Conformational States.
16	PDB:4eukB	0.077	0.220	3.835	152	0.047	0.158	4eukB.pdb.gz	Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
17	PDB:1zvuA	0.087	0.070	4.571	685	0.036	0.026	1zvuA.pdb.gz
18	PDB:3zxpA	0.074	0.092	4.571	394	0.063	0.081	3zxpA.pdb.gz
19	PDB:5oxpA	0.076	0.082	4.571	462	0.036	0.039	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
20	PDB:3ibgA	0.094	0.146	5.449	300	0.030	0.050	3ibgA.pdb.gz	Model for eukaryotic tail-anchored protein binding based on the structure of Get3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IQA6	0.0	650	507	0.630	0.629	Q6IQA6_DANRE CDK5 regulatory subunit-associated protein 3 OS=Danio rerio OX=7955 GN=cdkrap3 PE=1 SV=1
2	Q96JB5	0.0	1031	506	1.000	1.000	CK5P3_HUMAN CDK5 regulatory subunit-associated protein 3 OS=Homo sapiens OX=9606 GN=CDK5RAP3 PE=1 SV=2
3	Q99LM2	0.0	905	503	0.881	0.887	CK5P3_MOUSE CDK5 regulatory subunit-associated protein 3 OS=Mus musculus OX=10090 GN=Cdk5rap3 PE=1 SV=1
4	Q9JLH7	0.0	900	504	0.877	0.881	CK5P3_RAT CDK5 regulatory subunit-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Cdk5rap3 PE=1 SV=1
5	J3QRM1	8.77e-153	438	272	0.443	0.824	J3QRM1_HUMAN CDK5 regulatory subunit associated protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=CDK5RAP3 PE=1 SV=1
6	Q95SK3	1.50e-92	293	509	0.374	0.371	CK5P3_DROME CDK5RAP3-like protein OS=Drosophila melanogaster OX=7227 GN=CG30291 PE=2 SV=1
7	Q91411	1.2	34.3	764	0.057	0.038	Q91411_CHICK Myosin heavy chain (Fragment) OS=Gallus gallus OX=9031 GN=AMHC1 PE=2 SV=1
8	Q6QGE2	2.8	33.1	464	0.043	0.047	TUBE_BPT5 Tail tube protein pb6 OS=Escherichia phage T5 OX=2695836 GN=N4 PE=1 SV=1
9	Q6IVW2	3.3	32.7	675	0.077	0.058	Q6IVW2_DANRE IFT81 OS=Danio rerio OX=7955 GN=cdv1 PE=1 SV=1
10	Q02566	3.4	33.1	1938	0.059	0.015	MYH6_MOUSE Myosin-6 OS=Mus musculus OX=10090 GN=Myh6 PE=1 SV=2
11	P02563	3.7	32.7	1938	0.059	0.015	MYH6_RAT Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6 PE=1 SV=2
12	P13533	4.3	32.7	1939	0.059	0.015	MYH6_HUMAN Myosin-6 OS=Homo sapiens OX=9606 GN=MYH6 PE=1 SV=5
13	Q9Z1Z0	4.3	32.7	959	0.063	0.033	USO1_MOUSE General vesicular transport factor p115 OS=Mus musculus OX=10090 GN=Uso1 PE=1 SV=2
14	P38164	5.4	32.3	1038	0.057	0.028	SEA4_YEAST SEH-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEA4 PE=1 SV=2
15	O35488	6.0	32.0	620	0.042	0.034	S27A2_MOUSE Long-chain fatty acid transport protein 2 OS=Mus musculus OX=10090 GN=Slc27a2 PE=1 SV=2
16	Q9PTS2	6.0	32.0	369	0.067	0.092	DCUP_DANRE Uroporphyrinogen decarboxylase OS=Danio rerio OX=7955 GN=urod PE=1 SV=1
17	Q910C5	6.2	32.3	1931	0.087	0.023	Q910C5_CHICK Chick atrial myosin heavy chain OS=Gallus gallus OX=9031 PE=2 SV=1
18	C1P640	6.3	32.3	3683	0.032	0.004	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
19	C1P641	6.3	32.3	3663	0.032	0.004	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
20	G5EEV6	6.3	32.3	3704	0.032	0.004	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05600 CDK5RAP3	1.7e-185	629.3	CDK5 regulatory subunit-associated protein 3
2	PF20084 TrbK	4.6e+02	12.3	Conjugative transfer region protein TrbK

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358283	0.997	E3 UFM1-protein ligase 1
2	9606.ENSP00000346483	0.991	DDRGK domain-containing protein 1
3	9606.ENSP00000252037	0.864	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
4	9606.ENSP00000356982	0.808	Ubiquitin-fold modifier-conjugating enzyme 1
5	9606.ENSP00000264689	0.798	Ufm1-specific protease 2
6	9606.ENSP00000384273	0.768	Transcription factor p65
7	9606.ENSP00000348565	0.757	Ubiquitin-like modifier-activating enzyme 5
8	9606.ENSP00000418915	0.748	Cyclin-dependent kinase inhibitor 2A
9	9606.ENSP00000318486	0.742	Cyclin-dependent kinase 5 activator 1
10	9606.ENSP00000338171	0.708	Src kinase-associated phosphoprotein 1
11	9606.ENSP00000368970	0.705	Ubiquitin-fold modifier 1
12	9606.ENSP00000377059	0.705	Sorting nexin-11
13	9606.ENSP00000377060	0.678	Chromobox protein homolog 1
14	9606.ENSP00000354855	0.668	Nuclear factor erythroid 2-related factor 1
15	9606.ENSP00000418401	0.652	Signal recognition particle receptor subunit beta
16	9606.ENSP00000419782	0.638	Cyclin-dependent-like kinase 5
17	9606.ENSP00000289382	0.629	CCR4-NOT transcription complex subunit 11
18	9606.ENSP00000373413	0.627	Inactive Ufm1-specific protease 1
19	9606.ENSP00000361405	0.603	Matrix metalloproteinase-9
20	9606.ENSP00000258149	0.589	E3 ubiquitin-protein ligase Mdm2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044389	1.000	ubiquitin-like protein ligase binding
GO:0044877	0.869	protein-containing complex binding
GO:0019901	0.852	protein kinase binding
GO:0140297	0.739	DNA-binding transcription factor binding
GO:0061629	0.728	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0030332	0.691	cyclin binding
GO:0051059	0.681	NF-kappaB binding
GO:0051019	0.638	mitogen-activated protein kinase binding
GO:0097371	0.378	MDM2/MDM4 family protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0032502	0.960	developmental process
GO:0051726	0.943	regulation of cell cycle
GO:0031400	0.915	negative regulation of protein modification process
GO:0001932	0.891	regulation of protein phosphorylation
GO:0048523	0.889	negative regulation of cellular process
GO:0051348	0.869	negative regulation of transferase activity
GO:0045859	0.850	regulation of protein kinase activity
GO:0045936	0.846	negative regulation of phosphate metabolic process
GO:0071900	0.837	regulation of protein serine/threonine kinase activity
GO:0033673	0.837	negative regulation of kinase activity
GO:0071704	0.829	organic substance metabolic process
GO:0006469	0.824	negative regulation of protein kinase activity
GO:0048856	0.798	anatomical structure development
GO:0044238	0.776	primary metabolic process
GO:0032501	0.756	multicellular organismal process
GO:0050896	0.741	response to stimulus
GO:0006807	0.728	nitrogen compound metabolic process
GO:0044237	0.652	cellular metabolic process
GO:0048583	0.642	regulation of response to stimulus
GO:0023051	0.638	regulation of signaling
GO:0010646	0.637	regulation of cell communication
GO:0009966	0.584	regulation of signal transduction
GO:0009889	0.577	regulation of biosynthetic process
GO:0045786	0.561	negative regulation of cell cycle
GO:0071901	0.561	negative regulation of protein serine/threonine kinase activity
GO:0007275	0.559	multicellular organism development
GO:1901564	0.531	organonitrogen compound metabolic process
GO:0043170	0.524	macromolecule metabolic process
GO:0048518	0.513	positive regulation of biological process
GO:0051716	0.494	cellular response to stimulus
GO:0031326	0.472	regulation of cellular biosynthetic process
GO:0010556	0.470	regulation of macromolecule biosynthetic process
GO:0006950	0.465	response to stress
GO:0010468	0.465	regulation of gene expression
GO:0019538	0.465	protein metabolic process
GO:0033554	0.449	cellular response to stress
GO:0019219	0.447	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.443	regulation of RNA metabolic process
GO:0034976	0.431	response to endoplasmic reticulum stress
GO:0048522	0.406	positive regulation of cellular process
GO:0006355	0.393	regulation of DNA-templated transcription
GO:0071840	0.372	cellular component organization or biogenesis
GO:0036211	0.360	protein modification process
GO:0016043	0.346	cellular component organization
GO:0009968	0.308	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0031981	0.996	nuclear lumen
GO:0016020	0.994	membrane
GO:0032991	0.990	protein-containing complex
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0005829	0.985	cytosol
GO:0015630	0.765	microtubule cytoskeleton
GO:0005730	0.689	nucleolus
GO:0099080	0.587	supramolecular complex
GO:0005654	0.581	nucleoplasm
GO:0099081	0.459	supramolecular polymer
GO:0099512	0.448	supramolecular fiber
GO:0005815	0.444	microtubule organizing center
GO:0099513	0.422	polymeric cytoskeletal fiber
GO:0005874	0.402	microtubule
GO:0005886	0.337	plasma membrane
GO:0005813	0.323	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]