StarFunc result for job id Q96JB6

User Input

>input (756 residues)
MAWSPPATLFLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDD
NFAIQEATVACRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCGSNGWGVS
DCSHSEDVGVICHPRRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVE
VKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVDSHYYRKVWDLKMRDPKSRLKSLTN
KNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGMHAVVSCVAGPHFRPPKTKPQ
RKGSWAEEPRVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCRQLGFGSAREA
LFGARLGQGLGPIHLSEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQ
VRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWF
WSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQ
LVQETAYLEDRPLSQLYCAHEENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKT
GRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACAN
FGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCK
YDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DF27	0.776	0.757	0.000	776	0.538	0.524	B5DF27.pdb.gz	LOXL2_RAT Lysyl oxidase homolog 2 OS=Rattus norvegicus OX=10116 GN=Loxl2 PE=2 SV=2
2	AFDB:F1QQC3	0.842	0.863	0.000	737	0.558	0.573	F1QQC3.pdb.gz	LOL2A_DANRE Lysyl oxidase homolog 2A OS=Danio rerio OX=7955 GN=loxl2a PE=2 SV=1
3	AFDB:Q924C6	0.931	0.929	0.000	757	0.872	0.871	Q924C6.pdb.gz	LOXL4_MOUSE Lysyl oxidase homolog 4 OS=Mus musculus OX=10090 GN=Loxl4 PE=2 SV=2
4	AFDB:Q96JB6	1.000	1.000	0.000	756	1.000	1.000	Q96JB6.pdb.gz	LOXL4_HUMAN Lysyl oxidase homolog 4 OS=Homo sapiens OX=9606 GN=LOXL4 PE=1 SV=1
5	AFDB:Q9Z175	0.752	0.754	0.000	754	0.540	0.541	Q9Z175.pdb.gz	LOXL3_MOUSE Lysyl oxidase homolog 3 OS=Mus musculus OX=10090 GN=Loxl3 PE=1 SV=2
6	AFDB:B8A4W9	0.785	0.739	2.902E-102	807	0.538	0.504	B8A4W9.pdb.gz	LOX3B_DANRE Lysyl oxidase homolog 3B OS=Danio rerio OX=7955 GN=loxl3b PE=2 SV=1
7	AFDB:Q9Y4K0	0.774	0.757	3.819E-102	774	0.533	0.521	Q9Y4K0.pdb.gz	LOXL2_HUMAN Lysyl oxidase homolog 2 OS=Homo sapiens OX=9606 GN=LOXL2 PE=1 SV=1
8	AFDB:Q9UGM3	0.142	0.063	2.429E-39	2413	0.255	0.080	Q9UGM3.pdb.gz	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
9	AFDB:Q9V9X5	0.377	0.761	2.446E-36	360	0.173	0.364	Q9V9X5.pdb.gz	Q9V9X5_DROME Lysyl oxidase-like OS=Drosophila melanogaster OX=7227 GN=Loxl1 PE=2 SV=1
10	AFDB:Q60997	0.159	0.070	7.332E-36	2085	0.235	0.085	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
11	PDB:2xrcB	0.125	0.189	6.652E-4	485	0.037	0.058	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
12	PDB:2xrcC	0.117	0.188	4.797E-3	454	0.036	0.059	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
13	PDB:7tysA	0.060	0.102	4.808E-2	361	0.026	0.055	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
14	PDB:7zdzA	0.077	0.150	5.669E-2	325	0.024	0.055	7zdzA.pdb.gz
15	PDB:3lpfA	0.075	0.088	7.880E-2	603	0.022	0.028	3lpfA.pdb.gz	Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
16	PDB:7mjpA	0.068	0.117	1.157E-1	366	0.020	0.041	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
17	PDB:4h2aA	0.059	0.062	2.362E-1	704	0.025	0.027	4h2aA.pdb.gz	Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
18	PDB:3q8fA	0.091	0.104	2.941E-1	645	0.029	0.034	3q8fA.pdb.gz	pH effects on binding between the anthrax protective antigen and the host cellular receptor CMG2.
19	PDB:4ddnA	0.057	0.142	3.107E-1	154	0.029	0.143	4ddnA.pdb.gz	Ipomoelin, a jacalin-related lectin with a compact tetrameric association and versatile carbohydrate binding properties regulated by its N terminus.
20	PDB:1ca1A	0.048	0.084	3.663E-1	370	0.024	0.049	1ca1A.pdb.gz	Structure of the key toxin in gas gangrene.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DF27	0.0	860	776	0.542	0.528	LOXL2_RAT Lysyl oxidase homolog 2 OS=Rattus norvegicus OX=10116 GN=Loxl2 PE=2 SV=2
2	B8A4W9	0.0	848	807	0.546	0.512	LOX3B_DANRE Lysyl oxidase homolog 3B OS=Danio rerio OX=7955 GN=loxl3b PE=2 SV=1
3	F1QQC3	0.0	876	737	0.566	0.581	LOL2A_DANRE Lysyl oxidase homolog 2A OS=Danio rerio OX=7955 GN=loxl2a PE=2 SV=1
4	P58022	0.0	866	776	0.548	0.534	LOXL2_MOUSE Lysyl oxidase homolog 2 OS=Mus musculus OX=10090 GN=Loxl2 PE=1 SV=2
5	P58215	0.0	828	753	0.538	0.541	LOXL3_HUMAN Lysyl oxidase homolog 3 OS=Homo sapiens OX=9606 GN=LOXL3 PE=1 SV=1
6	Q924C6	0.0	1341	757	0.869	0.868	LOXL4_MOUSE Lysyl oxidase homolog 4 OS=Mus musculus OX=10090 GN=Loxl4 PE=2 SV=2
7	Q96JB6	0.0	1568	756	1.000	1.000	LOXL4_HUMAN Lysyl oxidase homolog 4 OS=Homo sapiens OX=9606 GN=LOXL4 PE=1 SV=1
8	Q9Y4K0	0.0	858	774	0.538	0.526	LOXL2_HUMAN Lysyl oxidase homolog 2 OS=Homo sapiens OX=9606 GN=LOXL2 PE=1 SV=1
9	Q9Z175	0.0	829	754	0.546	0.548	LOXL3_MOUSE Lysyl oxidase homolog 3 OS=Mus musculus OX=10090 GN=Loxl3 PE=1 SV=2
10	Q9V9X5	4.60e-70	236	360	0.183	0.383	Q9V9X5_DROME Lysyl oxidase-like OS=Drosophila melanogaster OX=7227 GN=Loxl1 PE=2 SV=1
11	Q9UGM3	6.52e-70	253	2413	0.249	0.078	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
12	Q60997	2.58e-64	236	2085	0.237	0.086	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
13	Q6NYT8	4.16e-64	221	408	0.144	0.267	Q6NYT8_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=zgc:77447 PE=2 SV=1
14	P16636	6.12e-64	221	411	0.148	0.273	LYOX_RAT Protein-lysine 6-oxidase OS=Rattus norvegicus OX=10116 GN=Lox PE=1 SV=2
15	P28301	7.51e-64	221	411	0.144	0.265	LYOX_MOUSE Protein-lysine 6-oxidase OS=Mus musculus OX=10090 GN=Lox PE=1 SV=1
16	P28300	1.75e-63	220	417	0.143	0.259	LYOX_HUMAN Protein-lysine 6-oxidase OS=Homo sapiens OX=9606 GN=LOX PE=1 SV=2
17	A6MH35	3.47e-62	217	444	0.151	0.257	A6MH35_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=loxl5b PE=2 SV=1
18	F1QGY9	1.53e-61	215	445	0.149	0.254	F1QGY9_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=loxl5b PE=3 SV=1
19	Q08397	2.71e-59	213	574	0.161	0.213	LOXL1_HUMAN Lysyl oxidase homolog 1 OS=Homo sapiens OX=9606 GN=LOXL1 PE=1 SV=2
20	Q2PS19	3.34e-59	211	526	0.139	0.200	Q2PS19_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=si:ch211-238c15.1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09272 Hepsin-SRCR	0.005	28.9	Hepsin, SRCR domain
2	PF01186 Lysyl_oxidase	5.2e-95	328.4	Lysyl oxidase
3	PF00530 SRCR	5.1e-93	317.3	Scavenger receptor cysteine-rich domain
4	PF15494 SRCR_2	1.6e-17	75.3	Scavenger receptor cysteine-rich domain
5	PF13992 YecR	10	17.8	YecR-like lipoprotein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260702

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351807	0.963	Elastin
2	9606.ENSP00000373783	0.956	Lysyl oxidase homolog 2
3	9606.ENSP00000305714	0.949	Bone morphogenetic protein 1
4	9606.ENSP00000345008	0.940	Fibulin-5
5	9606.ENSP00000264094	0.935	Lysyl oxidase homolog 3
6	9606.ENSP00000061240	0.931	Tolloid-like protein 1
7	9606.ENSP00000261921	0.931	Lysyl oxidase homolog 1
8	9606.ENSP00000231004	0.921	Protein-lysine 6-oxidase
9	9606.ENSP00000364685	0.919	Microfibrillar-associated protein 2
10	9606.ENSP00000352455	0.914	Microfibrillar-associated protein 5
11	9606.ENSP00000350630	0.910	Tolloid-like protein 2
12	9606.ENSP00000223061	0.905	Procollagen C-endopeptidase enhancer 1
13	9606.ENSP00000359583	0.591	Inactive heparanase-2
14	9606.ENSP00000282903	0.541	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
15	9606.ENSP00000196061	0.520	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
16	9606.ENSP00000263556	0.517	Prolyl 4-hydroxylase subunit alpha-1
17	9606.ENSP00000359170	0.508	Protein DPCD
18	9606.ENSP00000308727	0.502	Sushi domain containing 5
19	9606.ENSP00000354053	0.502	Glycosyltransferase 8 domain containing 2
20	9606.ENSP00000296130	0.500	Tetranectin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.989	catalytic activity
GO:0140096	0.929	catalytic activity, acting on a protein
GO:0016491	0.923	oxidoreductase activity
GO:0016641	0.852	oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor
GO:0004720	0.423	protein-lysine 6-oxidase activity
GO:0043167	0.317	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050789	0.984	regulation of biological process
GO:0050794	0.951	regulation of cellular process
GO:0071704	0.944	organic substance metabolic process
GO:0048856	0.938	anatomical structure development
GO:0044238	0.892	primary metabolic process
GO:0048519	0.871	negative regulation of biological process
GO:0006807	0.844	nitrogen compound metabolic process
GO:0032501	0.815	multicellular organismal process
GO:0043170	0.799	macromolecule metabolic process
GO:0048523	0.766	negative regulation of cellular process
GO:0048513	0.754	animal organ development
GO:0048518	0.730	positive regulation of biological process
GO:1901564	0.726	organonitrogen compound metabolic process
GO:0048869	0.722	cellular developmental process
GO:0007275	0.720	multicellular organism development
GO:0019538	0.697	protein metabolic process
GO:0030154	0.693	cell differentiation
GO:0010468	0.674	regulation of gene expression
GO:0010605	0.659	negative regulation of macromolecule metabolic process
GO:0009888	0.658	tissue development
GO:0048522	0.610	positive regulation of cellular process
GO:0051239	0.596	regulation of multicellular organismal process
GO:0060284	0.540	regulation of cell development
GO:0071840	0.537	cellular component organization or biogenesis
GO:0016043	0.492	cellular component organization
GO:0051094	0.491	positive regulation of developmental process
GO:0048731	0.440	system development
GO:0030155	0.435	regulation of cell adhesion
GO:0050896	0.431	response to stimulus
GO:0097435	0.366	supramolecular fiber organization
GO:0018205	0.343	peptidyl-lysine modification
GO:2000026	0.335	regulation of multicellular organismal development
GO:0051241	0.321	negative regulation of multicellular organismal process
GO:0060485	0.304	mesenchyme development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043227	0.950	membrane-bounded organelle
GO:0005615	0.829	extracellular space
GO:0005622	0.781	intracellular anatomical structure
GO:0043231	0.726	intracellular membrane-bounded organelle
GO:1903561	0.587	extracellular vesicle
GO:0070062	0.543	extracellular exosome
GO:0071944	0.521	cell periphery
GO:0032991	0.423	protein-containing complex
GO:0005737	0.374	cytoplasm
GO:0005634	0.308	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.923	Oxidoreductases.
EC:1.4.3.-	0.852	With oxygen as acceptor.
RHEA:24544	0.423	H2O + L-lysyl-[protein] + O2 = (S)-2-amino-6-oxohexanoyl-[protein] + H2O2 + NH4(+)
EC:1.4.3.13	0.423	protein-lysine 6-oxidase.

[back to server]