StarFunc result for job id Q96JE7

User Input

>input (1060 residues)
MELWAPQRLPQTRGKATAPSKDPDRGFRRDGHHRPVPHSWHNGERFHQWQDNRGSPQPQQ
EPRADHQQQPHYASRPGDWHQPVSGVDYYEGGYRNQLYSRPGYENSYQSYQSPTMREEYA
YGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSN
SRNPCKDSPASNSGQEWPGELFPGSLLAEAQKNKPSLASESNLLQQRESGLSSSSYELSQ
YIRDAPERDDPPASAAWSPVQADVSSAGPKAPMKFYIPHVPVSFGPGGQLVHVGPSSPTD
GQAALVELHSMEVILNDSEEQEEMRSFSGPLIREDVHKVDIMTFCQQKAAQSCKSETLGS
RDSALLWQLLVLLCRQNGSMVGSDIAELLMQDCKKLEKYKRQPPVANLINLTDEDWPVLS
SGTPNLLTGEIPPSVETPAQIVEKFTRLLYYGRKKEALEWAMKNHLWGHALFLSSKMDPQ
TYSWVMSGFTSTLALNDPLQTLFQLMSGRIPQAATCCGEKQWGDWRPHLAVILSNQAGDP
ELYQRAIVAIGDTLAGKGLVEAAHFCYLMAHVPFGHYTVKTDHLVLLGSSHSQEFLKFAT
TEAIQRTEIFEYCQMLGRPKSFIPSFQVYKLLYASRLADYGLVSQALHYCEAIGAAVLSQ
GESSHPVLLVELIKLAEKLKLSDPLVLERRSGDRDLEPDWLAQLRRQLEQKVAGDIGDPH
PTRSDISGAGGTTTENTFYQDFSGCQGYSEAPGYRSALWLTPEQTCLLQPSPQQPFPLQP
GSYPAGGGAGQTGTPRPFYSVPETHLPGTGSSVAVTEATGGTVWEEMLQTHLGPGENTVS
QETSQPPDGQEVISKPQTPLAARPRSISESSASSAKEDEKESSDEADKNSPRNTAQRGKL
GDGKEHTKSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLSLTP
SPESPPLPDVSAFSRGRGGGEGRGSASSGGAAAGAGVGGLSGPESVSFELCSNPGVLLPP
PALKGAVPLYNPSQVPQLPTATSLNRPNRLAQRRYPTQPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96JE7	1.000	1.000	0.000	1060	1.000	1.000	Q96JE7.pdb.gz	SC16B_HUMAN Protein transport protein Sec16B OS=Homo sapiens OX=9606 GN=SEC16B PE=1 SV=2
2	AFDB:E9QAT4	0.389	0.179	2.296E-41	2357	0.345	0.155	E9QAT4.pdb.gz	SC16A_MOUSE Protein transport protein Sec16A OS=Mus musculus OX=10090 GN=Sec16a PE=1 SV=1
3	AFDB:O15027	0.385	0.177	2.076E-40	2357	0.351	0.158	O15027.pdb.gz	SC16A_HUMAN Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4
4	AFDB:P48415	0.253	0.134	9.445E-14	2195	0.191	0.092	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
5	AFDB:A0A024RDH6	0.239	0.217	5.861E-8	1181	0.130	0.117	A0A024RDH6.pdb.gz
6	AFDB:Q385F2	0.208	0.185	6.864E-7	1231	0.112	0.097	Q385F2.pdb.gz	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1
7	PDB:4bzjC	0.196	0.270	6.007E-6	693	0.058	0.088	4bzjC.pdb.gz
8	AFDB:Q5ADP3	0.099	0.098	4.581E-3	1080	0.113	0.111	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
9	PDB:7fikB	0.113	0.171	7.445E-3	598	0.053	0.094	7fikB.pdb.gz
10	AFDB:O60184	0.081	0.079	8.383E-3	1102	0.158	0.152	O60184.pdb.gz	CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssn6 PE=1 SV=1
11	AFDB:F4HS99	0.072	0.052	1.236E-2	1797	0.103	0.061	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
12	AFDB:E9PW37	0.066	0.060	1.407E-2	1286	0.142	0.117	E9PW37.pdb.gz	E9PW37_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
13	PDB:6bq1B	0.101	0.137	1.843E-2	728	0.066	0.096	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
14	PDB:6wb92	0.076	0.172	2.493E-2	292	0.038	0.137	6wb92.pdb.gz
15	PDB:7kzpG	0.095	0.152	2.718E-2	577	0.064	0.118	7kzpG.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
16	PDB:5dseA	0.092	0.161	4.186E-2	537	0.061	0.121	5dseA.pdb.gz
17	PDB:7r5jP0	0.124	0.173	5.423E-2	655	0.066	0.107	7r5jP0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:5ok9B	0.052	0.181	7.336E-2	242	0.024	0.103	5ok9B.pdb.gz
19	PDB:7dkhI	0.113	0.127	9.924E-2	914	0.048	0.056	7dkhI.pdb.gz
20	PDB:4zdrA	0.064	0.216	1.130E-1	243	0.025	0.107	4zdrA.pdb.gz	Structure of the 14-3-3 zeta-LKB1 fusion protein provides insight into a novel ligand-binding mode of 14-3-3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PK14	0.0	1238	625	0.562	0.954	E9PK14_HUMAN Protein transport protein sec16 OS=Homo sapiens OX=9606 GN=SEC16B PE=1 SV=2
2	Q96JE7	0.0	2180	1060	1.000	1.000	SC16B_HUMAN Protein transport protein Sec16B OS=Homo sapiens OX=9606 GN=SEC16B PE=1 SV=2
3	A0A3F2YNX0	2.49e-144	479	2146	0.224	0.110	A0A3F2YNX0_HUMAN Protein transport protein sec16 (Fragment) OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=2
4	O15027	3.17e-144	480	2357	0.224	0.101	SC16A_HUMAN Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4
5	E9QAT4	1.36e-143	478	2357	0.222	0.100	SC16A_MOUSE Protein transport protein Sec16A OS=Mus musculus OX=10090 GN=Sec16a PE=1 SV=1
6	X2JEM2	2.88e-57	219	2326	0.149	0.068	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
7	A8JUU3	3.52e-57	219	2221	0.149	0.071	A8JUU3_DROME Secretory 16, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
8	X2JEY9	4.77e-57	218	2242	0.149	0.070	X2JEY9_DROME Secretory 16, isoform J OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
9	M9PHF1	5.36e-57	218	2250	0.149	0.070	M9PHF1_DROME Secretory 16, isoform F OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
10	X2JJP5	6.87e-57	218	2137	0.149	0.074	X2JJP5_DROME Secretory 16, isoform H OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
11	A8JUU1	7.35e-57	218	2021	0.149	0.078	A8JUU1_DROME Secretory 16, isoform E OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
12	Q5BI67	8.69e-57	218	1953	0.149	0.081	Q5BI67_DROME LP14866p OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=2 SV=1
13	Q9FGK9	2.18e-28	126	1350	0.074	0.058	MAG5_ARATH Protein transport protein SEC16A homolog OS=Arabidopsis thaliana OX=3702 GN=MAG5 PE=1 SV=1
14	P34643	2.38e-21	103	1232	0.096	0.083	SC161_CAEEL Protein transport protein sec-16A.1 OS=Caenorhabditis elegans OX=6239 GN=sec-16A.1 PE=1 SV=1
15	O14029	1.20e-11	72.0	1995	0.067	0.036	SEC16_SCHPO COPII coat assembly protein sec16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec16 PE=1 SV=2
16	P48415	1.13e-10	68.6	2195	0.100	0.048	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
17	Q57WC1	8.86e-06	52.4	1387	0.049	0.037	Q57WC1_TRYB2 Ancestral coatomer element 1 Sec16/Sec31 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.610 PE=3 SV=1
18	P49793	0.56	37.0	1816	0.030	0.018	NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus OX=10116 GN=Nup98 PE=1 SV=2
19	Q43387	2.5	34.3	328	0.021	0.067	PER71_ARATH Peroxidase 71 OS=Arabidopsis thaliana OX=3702 GN=PER71 PE=1 SV=1
20	A0A0S2Z5C3	3.7	33.9	392	0.019	0.051	A0A0S2Z5C3_HUMAN PAK1 interacting protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=PAK1IP1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12932 Sec16	0.0091	28.0	Vesicle coat trafficking protein Sec16 mid-region
2	PF12931 Sec16_C	2.9e-43	160.3	Sec23-binding domain of Sec16

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308339

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373312	0.997	Protein SEC13 homolog
2	9606.ENSP00000378721	0.973	Protein transport protein Sec31A
3	9606.ENSP00000343405	0.969	Protein transport protein Sec24C
4	9606.ENSP00000306881	0.960	Protein transport protein Sec23A
5	9606.ENSP00000380365	0.909	Regucalcin
6	9606.ENSP00000280551	0.907	Protein transport protein Sec24D
7	9606.ENSP00000428564	0.892	Protein transport protein Sec24B
8	9606.ENSP00000251047	0.891	Protein ERGIC-53
9	9606.ENSP00000362339	0.886	GTP-binding protein SAR1a
10	9606.ENSP00000381823	0.876	Protein transport protein Sec24A
11	9606.ENSP00000359370	0.874	Protein transport protein Sec31B
12	9606.ENSP00000295448	0.858	Glucosamine-6-phosphate deaminase 2
13	9606.ENSP00000281017	0.856	Transmembrane protein 18
14	9606.ENSP00000325827	0.842	Protein transport protein Sec16A
15	9606.ENSP00000385432	0.837	GTP-binding protein SAR1b
16	9606.ENSP00000394390	0.824	BTB/POZ domain-containing protein KCTD15
17	9606.ENSP00000321951	0.802	Protein lifeguard 2
18	9606.ENSP00000338844	0.776	Protein transport protein Sec23B
19	9606.ENSP00000285243	0.771	Ankyrin repeat domain-containing protein 40
20	9606.ENSP00000303222	0.771	Mitochondrial carrier homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.989	biological regulation
GO:0048193	0.978	Golgi vesicle transport
GO:0006888	0.974	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0048518	0.967	positive regulation of biological process
GO:0032880	0.964	regulation of protein localization
GO:0048522	0.957	positive regulation of cellular process
GO:0032386	0.945	regulation of intracellular transport
GO:0016043	0.933	cellular component organization
GO:0051050	0.932	positive regulation of transport
GO:0051223	0.918	regulation of protein transport
GO:1904951	0.887	positive regulation of establishment of protein localization
GO:0006996	0.880	organelle organization
GO:0033157	0.880	regulation of intracellular protein transport
GO:0032388	0.880	positive regulation of intracellular transport
GO:0051222	0.853	positive regulation of protein transport
GO:0007031	0.831	peroxisome organization
GO:0090316	0.831	positive regulation of intracellular protein transport
GO:0010256	0.654	endomembrane system organization
GO:0019222	0.609	regulation of metabolic process
GO:0007029	0.598	endoplasmic reticulum organization
GO:0060255	0.593	regulation of macromolecule metabolic process
GO:0009893	0.485	positive regulation of metabolic process
GO:0010604	0.472	positive regulation of macromolecule metabolic process
GO:0010468	0.456	regulation of gene expression
GO:0070861	0.368	regulation of protein exit from endoplasmic reticulum
GO:0048285	0.361	organelle fission
GO:0010628	0.310	positive regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070971	0.999	endoplasmic reticulum exit site
GO:0005829	0.998	cytosol
GO:0016020	0.884	membrane
GO:0031090	0.849	organelle membrane
GO:0031982	0.429	vesicle
GO:0031410	0.366	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]