StarFunc result for job id Q96JF0

User Input

>input (529 residues)
MKPHLKQWRQRMLFGIFAWGLLFLLIFIYFTDSNPAEPVPSSLSFLETRRLLPVQGKQRA
IMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKS
QSAFYPEDDDYFFAAGQPGWHSHTQGTLGFPSPGEPGPREGAFPAAQVQRRRVKKRHRRQ
RRSHVLEEGDDGDRLYSSMSRAFLYRLWKGNVSSKMLNPRLQKAMKDYLTANKHGVRFRG
KREAGLSRAQLLCQLRSRARVRTLDGTEAPFSALGWRRLVPAVPLSQLHPRGLRSCAVVM
SAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTTIRIINSQILTNPSHHFIDSS
LYKDVILVAWDPAPYSANLNLWYKKPDYNLFTPYIQHRQRNPNQPFYILHPKFIWQLWDI
IQENTKEKIQPNPPSSGFIGILIMMSMCREVHVYEYIPSVRQTELCHYHELYYDAACTLG
AYHPLLYEKLLVQRLNMGTQGDLHRKGKVVLPGFQAVHCPAPSPVIPHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96JF0	1.000	1.000	1.066E-94	529	1.000	1.000	Q96JF0.pdb.gz	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
2	AFDB:Q76K27	0.815	0.822	3.237E-77	524	0.771	0.779	Q76K27.pdb.gz	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
3	AFDB:P15907	0.572	0.743	3.965E-42	406	0.299	0.389	P15907.pdb.gz	SIAT1_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GAL1 PE=1 SV=1
4	AFDB:P13721	0.578	0.756	1.309E-41	403	0.291	0.382	P13721.pdb.gz	SIAT1_RAT Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St6gal1 PE=1 SV=2
5	PDB:6aplC	0.281	0.463	1.192E-7	306	0.125	0.216	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
6	AFDB:Q9NSC7	0.270	0.242	2.912E-7	600	0.187	0.165	Q9NSC7.pdb.gz	SIA7A_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GALNAC1 PE=1 SV=1
7	AFDB:Q54DM3	0.096	0.052	6.644E-2	1259	0.087	0.037	Q54DM3.pdb.gz	Q54DM3_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=blm PE=3 SV=1
8	PDB:5f55A	0.116	0.094	1.126E-1	705	0.059	0.044	5f55A.pdb.gz	Structural basis for DNA 5 -end resection by RecJ
9	PDB:4adeB	0.087	0.114	1.336E-1	350	0.055	0.083	4adeB.pdb.gz
10	AFDB:Q7SZP5	0.116	0.110	1.473E-1	588	0.119	0.107	Q7SZP5.pdb.gz
11	PDB:7pzyB	0.119	0.230	1.775E-1	208	0.064	0.163	7pzyB.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
12	PDB:6zekC	0.089	0.093	1.989E-1	478	0.055	0.061	6zekC.pdb.gz	Structure and substrate specificity determinants of the taurine biosynthetic enzyme cysteine sulphinic acid decarboxylase.
13	PDB:1sqfA	0.101	0.118	2.105E-1	425	0.078	0.096	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
14	PDB:1u0rD	0.080	0.117	2.105E-1	301	0.021	0.037	1u0rD.pdb.gz
15	PDB:1ksfX	0.105	0.086	2.359E-1	714	0.068	0.050	1ksfX.pdb.gz	Crystal structure of ClpA, an HSP100 chaperone and regulator of ClpAP protease
16	PDB:3lrpA	0.113	0.235	2.359E-1	181	0.043	0.127	3lrpA.pdb.gz	Structure of Plasmodium falciparum ADP-ribosylation factor 1.
17	AFDB:Q09811	0.123	0.064	2.601E-1	1328	0.104	0.041	Q09811.pdb.gz	HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rqh1 PE=1 SV=1
18	PDB:7q2dA	0.073	0.110	2.643E-1	286	0.025	0.045	7q2dA.pdb.gz	Fragment-Based Ligand Discovery Applied to the Mycolic Acid Methyltransferase Hma (MmaA4) from Mycobacterium tuberculosis : A Crystallographic and Molecular Modelling Study.
19	AFDB:Q8BPY9	0.103	0.087	2.914E-1	683	0.132	0.102	Q8BPY9.pdb.gz	FIGL1_MOUSE Fidgetin-like protein 1 OS=Mus musculus OX=10090 GN=Fignl1 PE=1 SV=1
20	AFDB:P42519	0.085	0.077	4.098E-1	597	0.096	0.085	P42519.pdb.gz	STAR_DROME Protein Star OS=Drosophila melanogaster OX=7227 GN=S PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q76K27	0.0	812	524	0.767	0.775	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
2	Q96JF0	0.0	1098	529	1.000	1.000	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
3	P15907	1.74e-108	331	406	0.293	0.382	SIAT1_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GAL1 PE=1 SV=1
4	P13721	8.38e-106	324	403	0.284	0.372	SIAT1_RAT Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St6gal1 PE=1 SV=2
5	Q64685	1.32e-102	316	403	0.280	0.367	SIAT1_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St6gal1 PE=1 SV=2
6	Q9W121	8.06e-64	216	451	0.195	0.228	Q9W121_DROME Sialyltransferase OS=Drosophila melanogaster OX=7227 GN=SiaT PE=2 SV=1
7	Q9GU23	1.50e-63	216	474	0.195	0.217	Q9GU23_DROME Beta-galactoside alpha-2,6-sialyltransferase OS=Drosophila melanogaster OX=7227 GN=SiaT PE=2 SV=1
8	Q9Y274	7.52e-16	80.9	331	0.134	0.215	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
9	Q9BVH7	1.74e-15	80.1	336	0.110	0.173	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
10	Q9H4F1	2.47e-15	79.0	302	0.095	0.166	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
11	P61131	1.33e-13	74.3	333	0.153	0.243	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
12	Q02734	1.60e-13	74.3	374	0.129	0.182	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
13	Q91Y74	1.90e-13	73.9	333	0.161	0.255	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
14	Q9QYJ1	2.10e-13	73.6	336	0.108	0.170	SIA7E_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Mus musculus OX=10090 GN=St6galnac5 PE=1 SV=1
15	Q11201	2.21e-13	73.6	340	0.106	0.165	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
16	Q9JM95	2.41e-13	73.6	333	0.089	0.141	SIA7F_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Mus musculus OX=10090 GN=St6galnac6 PE=1 SV=1
17	P97325	4.37e-13	73.2	374	0.127	0.179	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
18	P54751	4.56e-13	72.8	337	0.104	0.163	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
19	Q8NDV1	5.42e-13	72.0	305	0.093	0.161	SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
20	Q11206	6.07e-13	72.4	333	0.146	0.231	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	2.3e-32	124.2	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386942

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310696	0.960	Beta-1,4-galactosyltransferase 2
2	9606.ENSP00000369055	0.955	Beta-1,4-galactosyltransferase 1
3	9606.ENSP00000480428	0.947	Beta-1,4-galactosyltransferase 3
4	9606.ENSP00000169298	0.820	Beta-galactoside alpha-2,6-sialyltransferase 1
5	9606.ENSP00000264047	0.738	High affinity choline transporter 1
6	9606.ENSP00000355510	0.687	WD repeat-containing protein 64
7	9606.ENSP00000367096	0.687	Protocadherin-9
8	9606.ENSP00000485520	0.681	HCG1732469
9	9606.ENSP00000355517	0.672	Kynurenine 3-monooxygenase
10	9606.ENSP00000380692	0.650	Lysine-specific demethylase 7A
11	9606.ENSP00000283148	0.644	UDP-glucuronic acid decarboxylase 1
12	9606.ENSP00000300305	0.642	Runt-related transcription factor 1
13	9606.ENSP00000308318	0.642	Protein phosphatase 1 regulatory subunit 3B
14	9606.ENSP00000265000	0.633	N-acetylgalactosaminyltransferase 7
15	9606.ENSP00000321498	0.631	Sugar phosphate exchanger 3
16	9606.ENSP00000382163	0.623	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
17	9606.ENSP00000229329	0.618	N-acylneuraminate cytidylyltransferase
18	9606.ENSP00000364126	0.618	DNA-(apurinic or apyrimidinic site) lyase 2
19	9606.ENSP00000355512	0.592	Opsin-3
20	9606.ENSP00000411788	0.590	G-protein coupled receptor 35

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005488	0.996	binding
GO:0005515	0.993	protein binding
GO:0003835	0.360	beta-galactoside alpha-2,6-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0009987	0.954	cellular process
GO:0009311	0.932	oligosaccharide metabolic process
GO:1901564	0.872	organonitrogen compound metabolic process
GO:0044237	0.828	cellular metabolic process
GO:1901135	0.648	carbohydrate derivative metabolic process
GO:1901137	0.555	carbohydrate derivative biosynthetic process
GO:1901566	0.525	organonitrogen compound biosynthetic process
GO:0043170	0.521	macromolecule metabolic process
GO:0044249	0.512	cellular biosynthetic process
GO:0019538	0.510	protein metabolic process
GO:0036211	0.502	protein modification process
GO:0009100	0.476	glycoprotein metabolic process
GO:0070085	0.378	glycosylation
GO:0009101	0.374	glycoprotein biosynthetic process
GO:0006486	0.328	protein glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:11836	0.360	CMP-N-acetyl-beta-neuraminate + N-acetyl-beta-lactosamine = CMP + H(+) + N-acetyl-alpha-neuraminyl-(2->6)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosamine
EC:2.4.99.1	0.360	Transferred entry: 2.4.3.1.

[back to server]