StarFunc result for job id Q96JG9

User Input

>input (1400 residues)
MPGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMEL
PEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRY
ILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGF
HRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAE
NSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNG
PLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGA
AHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSP
GPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSA
PLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSS
QGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNT
AGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTH
YQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLS
SASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAP
RVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKL
DSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPP
LPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDS
GGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPE
ETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRG
PGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRS
PQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEP
ETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTA
PHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSK
ISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAP
PASSSCLCQDGEDAGSLEPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:X2JEM2	0.035	0.025	4.801E-5	2326	0.146	0.088	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
2	AFDB:Q8INM3	0.044	0.043	1.762E-4	1420	0.151	0.149	Q8INM3.pdb.gz	SLE_DROME Protein slender lobes OS=Drosophila melanogaster OX=7227 GN=sle PE=1 SV=1
3	AFDB:Q96T23	0.042	0.041	2.481E-4	1441	0.127	0.124	Q96T23.pdb.gz	RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2
4	AFDB:Q94185	0.036	0.040	1.044E-3	1254	0.102	0.114	Q94185.pdb.gz	Q94185_CAEEL DumPY: shorter than wild-type OS=Caenorhabditis elegans OX=6239 GN=dpy-6 PE=1 SV=2
5	AFDB:E7F958	0.035	0.031	1.282E-3	1715	0.145	0.118	E7F958.pdb.gz	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1
6	AFDB:Q86V38	0.034	0.040	3.341E-3	1191	0.159	0.187	Q86V38.pdb.gz	Q86V38_HUMAN Atrophin 1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=1
7	AFDB:Q8IHQ2	0.040	0.043	3.341E-3	1301	0.077	0.083	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
8	AFDB:O88466	0.031	0.025	6.624E-3	1888	0.149	0.110	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
9	AFDB:Q8NFU7	0.042	0.030	7.595E-3	2136	0.141	0.093	Q8NFU7.pdb.gz	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
10	AFDB:Q9VFH4	0.030	0.033	7.595E-3	1200	0.127	0.148	Q9VFH4.pdb.gz	Q9VFH4_DROME LD12755p OS=Drosophila melanogaster OX=7227 GN=l(3)L1231 PE=2 SV=1
11	PDB:5nrlU	0.019	0.098	3.700	196	0.005	0.036	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
12	PDB:2p01A	0.015	0.053	4.865	323	0.008	0.034	2p01A.pdb.gz
13	PDB:6g90U	0.016	0.090	5.578	196	0.004	0.031	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
14	PDB:4kfzB	0.011	0.095	7.854	148	0.004	0.041	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
15	PDB:7plo3	0.022	0.043	7.854	628	0.004	0.010	7plo3.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:7pntO	0.019	0.087	7.854	197	0.004	0.030	7pntO.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
17	PDB:7abiF	0.021	0.126	9.006	165	0.005	0.042	7abiF.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A571BEL3	0.0	1003	3765	0.514	0.191	A0A571BEL3_MOUSE Zinc finger protein 469 OS=Mus musculus OX=10090 GN=Zfp469 PE=4 SV=1
2	Q96JG9	0.0	2714	3925	1.000	0.357	ZN469_HUMAN Zinc finger protein 469 OS=Homo sapiens OX=9606 GN=ZNF469 PE=2 SV=3
3	Q54VJ6	1.0	36.2	462	0.019	0.058	Q54VJ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280299 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402343

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307297	0.921	Carbohydrate sulfotransferase 14
2	9606.ENSP00000360882	0.729	Collagen alpha-1(V) chain
3	9606.ENSP00000380901	0.709	Collagen alpha-2(VIII) chain
4	9606.ENSP00000338523	0.659	Fibronectin type III domain-containing protein 3B
5	9606.ENSP00000365899	0.645	Visual system homeobox 1
6	9606.ENSP00000223127	0.644	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
7	9606.ENSP00000282903	0.643	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
8	9606.ENSP00000280245	0.627	Coiled-coil domain containing 83
9	9606.ENSP00000196061	0.625	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
10	9606.ENSP00000263925	0.611	E3 ubiquitin-protein ligase LNX
11	9606.ENSP00000376902	0.610	Protein BANP
12	9606.ENSP00000222803	0.609	Peptidyl-prolyl cis-trans isomerase FKBP14
13	9606.ENSP00000439807	0.608	Multiple PDZ domain protein
14	9606.ENSP00000295992	0.606	Procollagen C-endopeptidase enhancer 2
15	9606.ENSP00000340668	0.595	Transmembrane protein 248
16	9606.ENSP00000419692	0.589	Retinoic acid receptor RXR-alpha
17	9606.ENSP00000305721	0.571	Inhibitor of Bruton tyrosine kinase
18	9606.ENSP00000029410	0.568	Beta-1,4-galactosyltransferase 7
19	9606.ENSP00000411418	0.566	Rab3 GTPase-activating protein catalytic subunit
20	9606.ENSP00000354053	0.561	Glycosyltransferase 8 domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0045892	0.946	negative regulation of DNA-templated transcription
GO:1903053	0.942	regulation of extracellular matrix organization
GO:0000122	0.925	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.992	nucleus
GO:0031974	0.959	membrane-enclosed lumen
GO:0070013	0.921	intracellular organelle lumen
GO:0005654	0.831	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]