StarFunc result for job id Q96JH7

User Input

>input (1222 residues)
MSQPPPPPPPLPPPPPPPEAPQTPSSLASAAASGGLLKRRDRRILSGSCPDPKCQARLFF
PASGSVSIECTECGQRHEQQQLLGVEEVTDPDVVLHNLLRNALLGVTGAPKKNTELVKVM
GLSNYHCKLLSPILARYGMDKQTGRAKLLRDMNQGELFDCALLGDRAFLIEPEHVNTVGY
GKDRSGSLLYLHDTLEDIKRANKSQECLIPVHVDGDGHCLVHAVSRALVGRELFWHALRE
NLKQHFQQHLARYQALFHDFIDAAEWEDIINECDPLFVPPEGVPLGLRNIHIFGLANVLH
RPIILLDSLSGMRSSGDYSATFLPGLIPAEKCTGKDGHLNKPICIAWSSSGRNHYIPLVG
IKGAALPKLPMNLLPKAWGVPQDLIKKYIKLEEDGGCVIGGDRSLQDKYLLRLVAAMEEV
FMDKHGIHPSLVADVHQYFYRRTGVIGVQPEEVTAAAKKAVMDNRLHKCLLCGALSELHV
PPEWLAPGGKLYNLAKSTHGQLRTDKNYSFPLNNLVCSYDSVKDVLVPDYGMSNLTACNW
CHGTSVRKVRGDGSIVYLDGDRTNSRSTGGKCGCGFKHFWDGKEYDNLPEAFPITLEWGG
RVVRETVYWFQYESDSSLNSNVYDVAMKLVTKHFPGEFGSEILVQKVVHTILHQTAKKNP
DDYTPVNIDGAHAQRVGDVQGQESESQLPTKIILTGQKTKTLHKEELNMSKTERTIQQNI
TEQASVMQKRKTEKLKQEQKGQPRTVSPSTIRDGPSSAPATPTKAPYSPTTSKEKKIRIT
TNDGRQSMVTLKSSTTFFELQESIAREFNIPPYLQCIRYGFPPKELMPPQAGMEKEPVPL
QHGDRITIEILKSKAEGGQSAAAHSAHTVKQEDIAVTGKLSSKELQEQAEKEMYSLCLLA
TLMGEDVWSYAKGLPHMFQQGGVFYSIMKKTMGMADGKHCTFPHLPGKTFVYNASEDRLE
LCVDAAGHFPIGPDVEDLVKEAVSQVRAEATTRSRESSPSHGLLKLGSGGVVKKKSEQLH
NVTAFQGKGHSLGTASGNPHLDPRARETSVVRKHNTGTDFSNSSTKTEPSVFTASSSNSE
LIRIAPGVVTMRDGRQLDPDLVEAQRKKLQEMVSSIQASMDRHLRDQSTEQSPSDLPQRK
TEVVSSSAKSGSLQTGLPESFPLTGGTENLNTETTDGCVADALGAAFATRSKAQRGNSVE
ELEEMDSQDAEMTNTTEPMDHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1REJ4	0.542	0.596	0.000	1108	0.641	0.707	F1REJ4.pdb.gz
2	AFDB:Q96JH7	0.999	0.999	0.000	1222	1.000	1.000	Q96JH7.pdb.gz	VCIP1_HUMAN Deubiquitinating protein VCPIP1 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2
3	PDB:3dbhI	0.059	0.691	2.173E-4	86	0.011	0.163	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
4	PDB:7rbsB	0.059	0.432	3.508E-4	157	0.011	0.089	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
5	PDB:6mdhA	0.055	0.416	2.142E-3	149	0.006	0.047	6mdhA.pdb.gz
6	PDB:6yvaC	0.059	0.401	3.458E-3	155	0.009	0.071	6yvaC.pdb.gz
7	PDB:3plvA	0.059	0.772	3.846E-3	80	0.007	0.100	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
8	PDB:3ai5A	0.056	0.218	5.019E-3	299	0.011	0.043	3ai5A.pdb.gz
9	PDB:6ef3u	0.055	0.712	5.019E-3	75	0.011	0.187	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
10	PDB:7np7D4	0.054	0.140	6.549E-3	415	0.016	0.048	7np7D4.pdb.gz
11	PDB:2k1fA	0.057	0.563	6.907E-3	88	0.009	0.125	2k1fA.pdb.gz
12	PDB:5xqmA	0.056	0.617	6.907E-3	90	0.011	0.144	5xqmA.pdb.gz
13	AFDB:Q8TEU7	0.066	0.052	3.709E-2	1601	0.080	0.061	Q8TEU7.pdb.gz	RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2
14	AFDB:P46379	0.051	0.054	4.839E-2	1132	0.048	0.052	P46379.pdb.gz	BAG6_HUMAN Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2
15	AFDB:Q9Z1R2	0.058	0.061	5.104E-2	1154	0.059	0.062	Q9Z1R2.pdb.gz	BAG6_MOUSE Large proline-rich protein BAG6 OS=Mus musculus OX=10090 GN=Bag6 PE=1 SV=1
16	AFDB:Q8RWK8	0.067	0.118	8.239E-2	608	0.051	0.102	Q8RWK8.pdb.gz	COIL_ARATH Coilin OS=Arabidopsis thaliana OX=3702 GN=COIL PE=1 SV=1
17	AFDB:Q9ESU6	0.041	0.038	1.735E-1	1400	0.052	0.045	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
18	AFDB:Q9FGF3	0.053	0.116	1.735E-1	513	0.048	0.115	Q9FGF3.pdb.gz	Q9FGF3_ARATH At5g64430 OS=Arabidopsis thaliana OX=3702 GN=At5g64430 PE=1 SV=1
19	AFDB:D3ZD05	0.036	0.048	3.116E-1	847	0.074	0.107	D3ZD05.pdb.gz	KANK2_RAT KN motif and ankyrin repeat domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Kank2 PE=1 SV=2
20	AFDB:Q16676	0.041	0.083	3.116E-1	465	0.056	0.148	Q16676.pdb.gz	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CDG3	0.0	2372	1220	0.939	0.941	VCIP1_MOUSE Deubiquitinating protein VCPIP1 OS=Mus musculus OX=10090 GN=Vcpip1 PE=1 SV=1
2	Q8CF97	0.0	2410	1221	0.945	0.946	VCIP1_RAT Deubiquitinating protein VCPIP1 OS=Rattus norvegicus OX=10116 GN=Vcpip1 PE=1 SV=2
3	Q96JH7	0.0	2541	1222	1.000	1.000	VCIP1_HUMAN Deubiquitinating protein VCPIP1 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2
4	P21580	4.37e-09	63.2	790	0.047	0.072	TNAP3_HUMAN Tumor necrosis factor alpha-induced protein 3 OS=Homo sapiens OX=9606 GN=TNFAIP3 PE=1 SV=1
5	Q60769	1.83e-07	58.2	775	0.043	0.068	TNAP3_MOUSE Tumor necrosis factor alpha-induced protein 3 OS=Mus musculus OX=10090 GN=Tnfaip3 PE=1 SV=2
6	A0JMB7	2.36e-05	51.2	917	0.042	0.056	A0JMB7_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=zgc:152772 PE=2 SV=1
7	Q6GQQ9	1.32e-04	48.9	843	0.037	0.053	OTU7B_HUMAN OTU domain-containing protein 7B OS=Homo sapiens OX=9606 GN=OTUD7B PE=1 SV=1
8	B2RUR8	1.37e-04	48.9	840	0.038	0.056	OTU7B_MOUSE OTU domain-containing protein 7B OS=Mus musculus OX=10090 GN=Otud7b PE=1 SV=1
9	Q8TE49	0.001	45.8	926	0.041	0.054	OTU7A_HUMAN OTU domain-containing protein 7A OS=Homo sapiens OX=9606 GN=OTUD7A PE=1 SV=1
10	Q5VVQ6	0.004	43.5	348	0.034	0.118	OTU1_HUMAN Ubiquitin thioesterase OTU1 OS=Homo sapiens OX=9606 GN=YOD1 PE=1 SV=1
11	Q5VV17	3.8	33.9	481	0.016	0.040	OTUD1_HUMAN OTU domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OTUD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02338 OTU	1.5e-08	46.6	OTU-like cysteine protease
2	PF00240 ubiquitin	1.1e+02	13.9	Ubiquitin family
3	PF19437 VCIP135_N	1.7e-79	276.7	VCIP135 N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309031

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351777	0.969	Transitional endoplasmic reticulum ATPase
2	9606.ENSP00000418529	0.956	NSFL1 cofactor p47
3	9606.ENSP00000378699	0.918	Cyclin-dependent kinase 1
4	9606.ENSP00000294179	0.880	Syntaxin-5
5	9606.ENSP00000331487	0.818	Nuclear protein localization protein 4 homolog
6	9606.ENSP00000301281	0.813	UBX domain-containing protein 6
7	9606.ENSP00000263202	0.771	Ubiquitin recognition factor in ER-associated degradation protein 1
8	9606.ENSP00000372210	0.766	BET1-like protein
9	9606.ENSP00000261942	0.744	FAS-associated factor 2
10	9606.ENSP00000296328	0.732	UBX domain-containing protein 7
11	9606.ENSP00000346986	0.729	WW domain-containing adapter protein with coiled-coil
12	9606.ENSP00000318147	0.727	ER degradation-enhancing alpha-mannosidase-like protein 3
13	9606.ENSP00000441543	0.701	Polyubiquitin-C
14	9606.ENSP00000326813	0.682	Ubiquitin thioesterase OTU1
15	9606.ENSP00000379865	0.682	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
16	9606.ENSP00000272638	0.675	UBX domain-containing protein 4
17	9606.ENSP00000265605	0.674	Aldehyde dehydrogenase family 8 member A1
18	9606.ENSP00000310661	0.672	cAMP-specific 3',5'-cyclic phosphodiesterase 7B
19	9606.ENSP00000434676	0.662	Inactive ubiquitin carboxyl-terminal hydrolase 50
20	9606.ENSP00000416097	0.643	Golgin subfamily A member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005515	0.868	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0009987	0.994	cellular process
GO:0070647	0.985	protein modification by small protein conjugation or removal
GO:0065007	0.906	biological regulation
GO:0050794	0.898	regulation of cellular process
GO:0006508	0.873	proteolysis
GO:0016579	0.771	protein deubiquitination
GO:0044237	0.741	cellular metabolic process
GO:0050896	0.710	response to stimulus
GO:0051716	0.673	cellular response to stimulus
GO:0044260	0.634	cellular macromolecule metabolic process
GO:0006950	0.546	response to stress
GO:0033554	0.470	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.997	intracellular organelle lumen
GO:0012505	0.995	endomembrane system
GO:0005737	0.991	cytoplasm
GO:0005634	0.987	nucleus
GO:0005829	0.957	cytosol
GO:0031981	0.957	nuclear lumen
GO:0005783	0.943	endoplasmic reticulum
GO:0005654	0.745	nucleoplasm
GO:0016020	0.560	membrane
GO:0030054	0.390	cell junction
GO:0005788	0.366	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]