StarFunc result for job id Q96JH8

User Input

>input (1075 residues)
MFYGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLS
APGVLKVFGDSVCTGTHYKSVLATGTSSARELVKEALERYALDPRQAGQYVLCDVVGQAG
DAGQRWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRSDVEELAAKEVDTITAGI
NAQARRLQRSRAKGTPTPALGDARSSPPPRLRRTVSETSLSPVNALPAAAQGPEEPGPDA
MRYSLYQSPHLLLLQGYSQQHDSLVYVLNRDRHTVGQRTPSSKPSISLSAPDILPLHCTI
RRQPLPDSGQAAGRLVLEPIPGAHISVNFSEVGHRTVVLHHGDLLSLGLYYLLLFKDPAQ
AQPLPARALARLRAVPQSCRLCGAALGARGAASPTQAALPRRQQLLLEFEPHLEDTLLQR
IMTLIEPGGDDHKLTPAFLLCLCIQHSATHFQPGTFGQLLLKIARLIRETVWEKTKELAE
KQAQLQEPISLASCAMADLVPDLQPILFWMSNSIELLYFIQQKCPLYMQSMEEQLDITGS
KESLFSCTLTASEEAMAVLEEVVLYAFQQCVYYVSKSLYICLPALLECPPFQTERRESWS
SAPELPEELRRVVSVYQAALDLLRQLQVHPEVASQMLAYLFFFSGTLLLNQLLDRGPSLS
CFHWPRGVQACARLQQLLEWMRSAGFGAAGEHFFQKLSCTLNLLATPRAQLIQMSWTALR
AAFPALSPAQLHRLLTHYQLASAMGPMSTWEPGAQDSPEAFRSEDVLESYENPPPIVLPS
DGFQVDLEANCLDDSIYQHLLYVRHFLWGLRSRASPGSPGRPGSGASQPVCPEGMHHVVL
DGHLEAPSCPLAPRDPGPAAREVAPERTLPLRGAPWAQAPPGRQPSRGGSQAGPPHTDSS
CLLTPPSTPLGPEPGDPDWPESGGPCGKALPERQRNGLSGLRGAAPEGDSAALAEESPPA
PSSRSSSTEDFCYVFTVELERGPSGLGMGLIDGMHTHLGAPGLYIQTLLPGSPAAADGRL
SLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFRTPPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69Z89	0.510	0.500	0.000	1099	0.809	0.792	Q69Z89.pdb.gz	RADIL_MOUSE Ras-associating and dilute domain-containing protein OS=Mus musculus OX=10090 GN=Radil PE=1 SV=2
2	AFDB:Q96JH8	1.000	1.000	0.000	1075	1.000	1.000	Q96JH8.pdb.gz	RADIL_HUMAN Ras-associating and dilute domain-containing protein OS=Homo sapiens OX=9606 GN=RADIL PE=1 SV=5
3	AFDB:A7UA95	0.411	0.394	5.115E-94	1124	0.516	0.494	A7UA95.pdb.gz	RADIL_DANRE Ras-associating and dilute domain-containing protein OS=Danio rerio OX=7955 GN=radil PE=2 SV=1
4	AFDB:Q5U651	0.372	0.412	7.469E-49	963	0.277	0.309	Q5U651.pdb.gz	RAIN_HUMAN Ras-interacting protein 1 OS=Homo sapiens OX=9606 GN=RASIP1 PE=1 SV=1
5	AFDB:Q810W9	0.081	0.093	7.645E-6	920	0.095	0.111	Q810W9.pdb.gz	WHRN_RAT Whirlin OS=Rattus norvegicus OX=10116 GN=Whrn PE=1 SV=1
6	AFDB:Q8SY14	0.083	0.084	1.553E-5	1058	0.053	0.054	Q8SY14.pdb.gz	Q8SY14_DROME RE14068p OS=Drosophila melanogaster OX=7227 GN=Grip PE=2 SV=1
7	AFDB:F1Q897	0.082	0.059	1.623E-5	1503	0.052	0.037	F1Q897.pdb.gz	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
8	PDB:7wrgA	0.101	0.130	2.493E-4	812	0.028	0.037	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
9	PDB:5gm6U	0.091	0.489	2.606E-4	176	0.025	0.153	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
10	PDB:7wrgB	0.097	0.130	3.715E-4	783	0.028	0.038	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
11	PDB:7dvqX	0.089	0.538	5.534E-4	156	0.016	0.109	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:2xkxA	0.077	0.114	1.029E-3	721	0.024	0.036	2xkxA.pdb.gz
13	AFDB:P28191	0.084	0.087	1.044E-3	1026	0.046	0.048	P28191.pdb.gz	PTP1_CAEEL Tyrosine-protein phosphatase 1 OS=Caenorhabditis elegans OX=6239 GN=ptp-1 PE=2 SV=3
14	AFDB:Q6P0Q8	0.086	0.059	1.302E-3	1798	0.169	0.101	Q6P0Q8.pdb.gz	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
15	AFDB:A0A0R4IF44	0.074	0.049	1.555E-3	1792	0.111	0.066	A0A0R4IF44.pdb.gz
16	PDB:7p73A	0.081	0.203	2.387E-3	420	0.031	0.079	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:7pc3A	0.081	0.213	2.608E-3	405	0.024	0.064	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7qqmA	0.083	0.209	3.717E-3	413	0.023	0.061	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:6l9wD	0.089	0.560	7.891E-3	142	0.011	0.085	6l9wD.pdb.gz
20	PDB:7pe9I	0.072	0.236	1.125E-2	317	0.019	0.063	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7UA95	0.0	996	1124	0.517	0.495	RADIL_DANRE Ras-associating and dilute domain-containing protein OS=Danio rerio OX=7955 GN=radil PE=2 SV=1
2	Q69Z89	0.0	1682	1099	0.809	0.792	RADIL_MOUSE Ras-associating and dilute domain-containing protein OS=Mus musculus OX=10090 GN=Radil PE=1 SV=2
3	Q96JH8	0.0	2172	1075	1.000	1.000	RADIL_HUMAN Ras-associating and dilute domain-containing protein OS=Homo sapiens OX=9606 GN=RADIL PE=1 SV=5
4	Q3U0S6	7.20e-139	444	961	0.292	0.327	RAIN_MOUSE Ras-interacting protein 1 OS=Mus musculus OX=10090 GN=Rasip1 PE=1 SV=3
5	Q5U651	8.65e-137	439	963	0.293	0.327	RAIN_HUMAN Ras-interacting protein 1 OS=Homo sapiens OX=9606 GN=RASIP1 PE=1 SV=1
6	J9PJE8	1.68e-87	305	989	0.189	0.205	J9PJE8_DANRE Ras-interacting protein 1 OS=Danio rerio OX=7955 GN=rasip1 PE=1 SV=1
7	E7F6P4	1.94e-87	305	989	0.189	0.205	E7F6P4_DANRE Ras-interacting protein 1 OS=Danio rerio OX=7955 GN=rasip1 PE=1 SV=3
8	Q9QZQ1	6.19e-15	82.8	1820	0.162	0.096	AFAD_MOUSE Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3
9	A8MQ02	1.02e-14	82.0	1781	0.162	0.098	A8MQ02_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
10	P55196	1.46e-14	81.3	1824	0.162	0.095	AFAD_HUMAN Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3
11	Q5TIG5	1.79e-14	81.3	1665	0.162	0.105	Q5TIG5_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
12	O35889	7.15e-14	79.0	1829	0.164	0.096	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
13	Q12923	6.12e-12	72.8	2485	0.034	0.015	PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13 PE=1 SV=2
14	Q64512	1.22e-11	72.0	2453	0.034	0.015	PTN13_MOUSE Tyrosine-protein phosphatase non-receptor type 13 OS=Mus musculus OX=10090 GN=Ptpn13 PE=1 SV=2
15	Q5F488	1.58e-11	71.2	1128	0.033	0.032	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
16	Q5TCQ9	2.01e-11	70.9	1481	0.034	0.025	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
17	A0A087WT53	2.04e-11	70.9	1155	0.032	0.029	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
18	Q86UL8	2.31e-11	70.9	1455	0.033	0.024	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
19	Q9JK71	2.57e-11	70.9	1470	0.034	0.025	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
20	Q9EQJ9	2.59e-11	70.9	1476	0.034	0.025	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01843 DIL	4.5e-17	73.5	DIL domain
2	PF00498 FHA	1.3e+02	14.3	FHA domain
3	PF00595 PDZ	1.5e-08	46.2	PDZ domain
4	PF13180 PDZ_2	1.7e+02	14.0	PDZ domain
5	PF17820 PDZ_6	0.0024	29.1	PDZ domain
6	PF00788 RA	4e-16	70.8	Ras association (RalGDS/AF-6) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382492

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297562	0.778	AP-5 complex subunit zeta-1
2	9606.ENSP00000358723	0.743	Ras-related protein Rap-1A
3	9606.ENSP00000256196	0.723	Ras-related protein R-Ras2
4	9606.ENSP00000260526	0.685	Rho GTPase-activating protein 29
5	9606.ENSP00000324901	0.680	IQ motif containing K
6	9606.ENSP00000085068	0.644	Isochorismatase domain containing 2
7	9606.ENSP00000171757	0.641	Putative P2Y purinoceptor 10
8	9606.ENSP00000376024	0.587	Sorting nexin-9
9	9606.ENSP00000377037	0.521	Ras-GEF domain-containing family member 1C
10	9606.ENSP00000407586	0.509	GTPase HRas
11	9606.ENSP00000317332	0.508	Sorting nexin-18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.420	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.793	biological regulation
GO:0050789	0.707	regulation of biological process
GO:0034446	0.677	substrate adhesion-dependent cell spreading
GO:0050794	0.594	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0099080	0.991	supramolecular complex
GO:0005856	0.988	cytoskeleton
GO:0099081	0.976	supramolecular polymer
GO:0099512	0.964	supramolecular fiber
GO:0005737	0.957	cytoplasm
GO:0005829	0.943	cytosol
GO:0015630	0.910	microtubule cytoskeleton
GO:0016020	0.872	membrane
GO:0099513	0.732	polymeric cytoskeletal fiber
GO:0043227	0.716	membrane-bounded organelle
GO:0005874	0.700	microtubule
GO:0043231	0.448	intracellular membrane-bounded organelle
GO:0071944	0.389	cell periphery
GO:0030054	0.359	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]