StarFunc result for job id Q96JJ6

User Input

>input (628 residues)
MSPGGKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHS
YQGHWQQGKREGLGVERKSRWTYRGEWLGGLKGRSGVWESVSGLRYAGLWKDGFQDGYGT
ETYSDGGTYQGQWQAGKRHGYGVRQSVPYHQAALLRSPRRTSLDSGHSDPPTPPPPLPLP
GDEGGSPASGSRGGFVLAGPGDADGASSRKRTPAAGGFFRRSLLLSGLRAGGRRSSLGSK
RGSLRSEVSSEVGSTGPPGSEASGPPAAAPPALIEGSATEVYAGEWRADRRSGFGVSQRS
NGLRYEGEWLGNRRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLALRRGKVKEKV
DRAVEGARRAVSAARQRQEIAAARAADALLKAVAASSVAEKAVEAARMAKLIAQDLQPML
EAPGRRPRQDSEGSDTEPLDEDSPGVYENGLTPSEGSPELPSSPASSRQPWRPPACRSPL
PPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSG
SLREEEGEDEEPLPPLRAPAGTEPEPIAMLVLRGSSSRGPDAGCLTEELGEPAATERPAQ
PGAANPLVVGAVALLDLSLAFLFSQLLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80WT0	0.582	0.582	2.453E-91	628	0.962	0.962	Q80WT0.pdb.gz	JPH4_MOUSE Junctophilin-4 OS=Mus musculus OX=10090 GN=Jph4 PE=2 SV=1
2	AFDB:Q9BR39	0.506	0.459	2.009E-52	696	0.452	0.408	Q9BR39.pdb.gz	JPH2_HUMAN Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2
3	AFDB:Q9ET78	0.535	0.486	1.334E-51	696	0.455	0.411	Q9ET78.pdb.gz	JPH2_MOUSE Junctophilin-2 OS=Mus musculus OX=10090 GN=Jph2 PE=1 SV=2
4	AFDB:Q9HDC5	0.516	0.492	6.708E-51	661	0.416	0.395	Q9HDC5.pdb.gz	JPH1_HUMAN Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2
5	AFDB:Q22667	0.516	0.437	7.907E-48	747	0.338	0.284	Q22667.pdb.gz	Q22667_CAEEL Junctophilin-1 OS=Caenorhabditis elegans OX=6239 GN=jph-1 PE=1 SV=2
6	PDB:7dmpA	0.215	0.692	7.244E-9	186	0.064	0.215	7dmpA.pdb.gz
7	PDB:6jleA	0.152	0.578	7.512E-8	144	0.059	0.257	6jleA.pdb.gz
8	PDB:1fj1E	0.116	0.255	7.474E-2	251	0.025	0.064	1fj1E.pdb.gz
9	PDB:7z8bF	0.086	0.110	1.104E-1	457	0.040	0.055	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
10	PDB:8gqeB	0.085	0.123	1.379E-1	386	0.051	0.083	8gqeB.pdb.gz
11	PDB:2oy5O	0.104	0.228	1.458E-1	250	0.033	0.084	2oy5O.pdb.gz
12	PDB:4a11B	0.064	0.086	1.723E-1	365	0.024	0.041	4a11B.pdb.gz
13	PDB:7rroe	0.078	0.080	3.554E-1	610	0.033	0.034	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:7mqaLW	0.067	0.081	3.973E-1	452	0.035	0.049	7mqaLW.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:3spwA	0.086	0.116	4.695E-1	398	0.021	0.033	3spwA.pdb.gz	Osh4p exchanges sterols for phosphatidylinositol 4-phosphate between lipid bilayers.
16	AFDB:P15276	0.099	0.153	5.543E-1	352	0.068	0.122	P15276.pdb.gz	ALGP_PSEAE Transcriptional regulatory protein AlgP OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=algP PE=4 SV=2
17	AFDB:Q9W6J4	0.060	0.044	5.861E-1	893	0.108	0.076	Q9W6J4.pdb.gz
18	AFDB:E7F4A6	0.088	0.079	7.742E-1	745	0.126	0.106	E7F4A6.pdb.gz
19	AFDB:Q500P4	0.109	0.191	8.655E-1	338	0.059	0.109	Q500P4.pdb.gz	Q500P4_PSEU2 Alginate regulatory protein AlgR3 OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=Psyr_0054 PE=4 SV=1
20	AFDB:Q9NHF0	0.092	0.076	1.209	823	0.143	0.109	Q9NHF0.pdb.gz	Q9NHF0_DROME Katanin p80 WD40 repeat-containing subunit B1 OS=Drosophila melanogaster OX=7227 GN=kat80 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80WT0	0.0	1086	628	0.962	0.962	JPH4_MOUSE Junctophilin-4 OS=Mus musculus OX=10090 GN=Jph4 PE=2 SV=1
2	Q96JJ6	0.0	1226	628	1.000	1.000	JPH4_HUMAN Junctophilin-4 OS=Homo sapiens OX=9606 GN=JPH4 PE=1 SV=2
3	Q8WXH2	4.99e-136	417	748	0.406	0.341	JPH3_HUMAN Junctophilin-3 OS=Homo sapiens OX=9606 GN=JPH3 PE=1 SV=2
4	Q9ET77	6.10e-136	416	744	0.403	0.340	JPH3_MOUSE Junctophilin-3 OS=Mus musculus OX=10090 GN=Jph3 PE=1 SV=1
5	Q9HDC5	1.07e-125	387	661	0.377	0.359	JPH1_HUMAN Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2
6	Q9ET80	1.82e-122	379	660	0.365	0.347	JPH1_MOUSE Junctophilin-1 OS=Mus musculus OX=10090 GN=Jph1 PE=1 SV=1
7	Q9ET78	4.09e-120	374	696	0.409	0.369	JPH2_MOUSE Junctophilin-2 OS=Mus musculus OX=10090 GN=Jph2 PE=1 SV=2
8	Q9BR39	4.88e-116	363	696	0.406	0.366	JPH2_HUMAN Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2
9	Q22667	6.61e-107	341	747	0.318	0.268	Q22667_CAEEL Junctophilin-1 OS=Caenorhabditis elegans OX=6239 GN=jph-1 PE=1 SV=2
10	Q57WF5	6.59e-14	76.6	437	0.091	0.130	Q57WF5_TRYB2 MORN repeat-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.670 PE=4 SV=1
11	Q9M1K2	1.81e-13	76.3	779	0.073	0.059	PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 4 OS=Arabidopsis thaliana OX=3702 GN=PIP5K4 PE=4 SV=1
12	Q38AY3	1.21e-12	73.2	690	0.153	0.139	Q38AY3_TRYB2 MORN repeat-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0600 PE=4 SV=1
13	Q8L850	3.83e-12	72.0	815	0.091	0.070	PI5K9_ARATH Phosphatidylinositol 4-phosphate 5-kinase 9 OS=Arabidopsis thaliana OX=3702 GN=PIP5K9 PE=1 SV=2
14	Q9SLG9	6.97e-12	70.9	772	0.072	0.058	PI5K5_ARATH Phosphatidylinositol 4-phosphate 5-kinase 5 OS=Arabidopsis thaliana OX=3702 GN=PIP5K5 PE=2 SV=1
15	O48709	1.02e-11	70.5	705	0.078	0.070	PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 3 OS=Arabidopsis thaliana OX=3702 GN=PIP5K3 PE=4 SV=1
16	Q9SFB8	7.73e-11	67.4	715	0.073	0.064	PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Arabidopsis thaliana OX=3702 GN=PIP5K6 PE=2 SV=1
17	Q587D3	2.90e-10	64.7	358	0.084	0.148	Q587D3_TRYB2 MORN repeat-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.330 PE=1 SV=1
18	Q8L796	3.73e-10	65.5	754	0.075	0.062	PI5K2_ARATH Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PIP5K2 PE=1 SV=2
19	Q56YP2	2.31e-09	62.8	752	0.089	0.074	PI5K1_ARATH Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PIP5K1 PE=1 SV=1
20	Q60I27	5.47e-09	61.6	953	0.081	0.054	AL2CL_HUMAN ALS2 C-terminal-like protein OS=Homo sapiens OX=9606 GN=ALS2CL PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02493 MORN	1.1e-25	99.0	MORN repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380307

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368767	0.717	Aspartyl/asparaginyl beta-hydroxylase
2	9606.ENSP00000439281	0.717	Triadin
3	9606.ENSP00000256255	0.710	Store-operated calcium entry-associated regulatory factor
4	9606.ENSP00000352608	0.703	Ryanodine receptor 1
5	9606.ENSP00000284262	0.701	Junctophilin-3
6	9606.ENSP00000365503	0.661	Protein shisa-7
7	9606.ENSP00000478059	0.661	Stromal interaction molecule 1
8	9606.ENSP00000366902	0.641	Telomere zinc finger-associated protein
9	9606.ENSP00000419195	0.638	CaM kinase-like vesicle-associated protein
10	9606.ENSP00000344488	0.579	Junctophilin-1
11	9606.ENSP00000362071	0.577	Junctophilin-2
12	9606.ENSP00000429562	0.566	Protein unc-13 homolog A
13	9606.ENSP00000402394	0.552	Carbohydrate sulfotransferase 15
14	9606.ENSP00000341815	0.546	Transcription factor SOX-18
15	9606.ENSP00000355533	0.519	Ryanodine receptor 2
16	9606.ENSP00000482128	0.511	Cytoplasmic polyadenylation element-binding protein 3
17	9606.ENSP00000316377	0.510	Disks large-associated protein 1
18	9606.ENSP00000405514	0.506	Neurabin-1
19	9606.ENSP00000454014	0.502	Protein shisa-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.314	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0051924	0.992	regulation of calcium ion transport
GO:0009987	0.985	cellular process
GO:0006810	0.981	transport
GO:0034762	0.967	regulation of transmembrane transport
GO:0065008	0.964	regulation of biological quality
GO:0051282	0.962	regulation of sequestering of calcium ion
GO:1904062	0.961	regulation of monoatomic cation transmembrane transport
GO:0006811	0.956	monoatomic ion transport
GO:0032412	0.930	regulation of monoatomic ion transmembrane transporter activity
GO:0098660	0.927	inorganic ion transmembrane transport
GO:0030001	0.927	metal ion transport
GO:0098662	0.920	inorganic cation transmembrane transport
GO:0098655	0.920	monoatomic cation transmembrane transport
GO:0006816	0.916	calcium ion transport
GO:1903169	0.915	regulation of calcium ion transmembrane transport
GO:2001257	0.885	regulation of cation channel activity
GO:0032501	0.883	multicellular organismal process
GO:0070588	0.872	calcium ion transmembrane transport
GO:0051279	0.846	regulation of release of sequestered calcium ion into cytosol
GO:0007204	0.841	positive regulation of cytosolic calcium ion concentration
GO:0097553	0.801	calcium ion transmembrane import into cytosol
GO:1901019	0.730	regulation of calcium ion transmembrane transporter activity
GO:0003008	0.425	system process
GO:0010646	0.403	regulation of cell communication
GO:0023051	0.361	regulation of signaling
GO:0007610	0.337	behavior
GO:0050890	0.322	cognition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.998	endoplasmic reticulum
GO:0016020	0.997	membrane
GO:0031090	0.959	organelle membrane
GO:0071944	0.958	cell periphery
GO:0005886	0.950	plasma membrane
GO:0098588	0.901	bounding membrane of organelle
GO:0016528	0.851	sarcoplasm
GO:0005789	0.835	endoplasmic reticulum membrane
GO:0016529	0.679	sarcoplasmic reticulum
GO:0033017	0.535	sarcoplasmic reticulum membrane
GO:0042995	0.443	cell projection
GO:0120025	0.434	plasma membrane bounded cell projection
GO:0043005	0.413	neuron projection
GO:0032991	0.349	protein-containing complex
GO:0043232	0.338	intracellular non-membrane-bounded organelle
GO:0036477	0.307	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]